KEGG   Oryzias latipes (Japanese medaka): 101159551Help
Entry
101159551         CDS       T02443                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ola00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:ola00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 445 aa AA seqDB search
MTSIPDLIRKKRDGGQLTDEDIRVFIGAVTGKTIQDCQTGAMLMAIWQRGMVTAETTTFT
REMMSSGEVMSWPDEWRGLMVDKHSTGGVGDKVSLVLAPALAACGCKVPMISGRGLAHTG
GTLDKLESIPGFQIQQSSEQIRNILGSVGCCIVGQTERLVPADRVLYALRDATSTVDSLP
LITGSIISKKGAESLSALVLDVKFGRAALYKDQQGARELADMLMSAGNGLGIRTGAVLSR
MDGVIGRRVGNSLEVMECLETLKGNGPDDLMELTTTLGGLLLTMTGAASDLSEGRRRLSD
AVIGGAALSKFQAMMEAQGVAKETAEELCSAHTDYFKVFRKSEHQMELTAAADGIVCDID
GMVVAQVLHKLGAGRSMAGDPVNHSVGAELLVSLDQRVRTGSPWLRLHYEDPAPSPDQIQ
QLQKALTVGTRTQQNRPLVEEVLLS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacctccatccccgacctgatccggaagaagagagacggaggtcagctgaccgatgaa
gacatcagagtcttcatcggggctgtcacagggaagaccattcaggactgtcagacagga
gccatgctgatggccatctggcagcgggggatggtcaccgccgagaccaccaccttcaca
agagagatgatgtcatcaggggaagtgatgtcgtggccagacgagtggagggggttgatg
gtggacaaacactctacagggggggtgggggacaaagtcagcctggttctggcgccagca
ctcgccgcctgcggctgcaaggtgccgatgatcagtgggcggggcctagcccacacagga
ggaactttggacaagctggaatcgattccagggttccagatccagcagtcgtccgaacag
atcaggaacatcctgggctcggtgggctgctgcattgtgggtcagacagaaaggctggtt
ccagcagatcgggtcctgtatgctctgcgggacgccacaagcactgtggacagcctgcct
ctaattactggatccatcatctcaaagaaaggggcggagtctctgtccgctctggttctg
gatgtgaagtttggacgggccgctctctacaaagaccagcagggagctcgggaacttgct
gacatgctgatgagtgcggggaacgggttgggcatccggacgggggccgtcctcagccgt
atggacggcgtgatcggccggcgtgtgggaaacagtcttgaagtgatggaatgtctggag
acgctgaaggggaacggacccgacgacctgatggagctgaccaccacgctaggcggcctg
ctgctgaccatgacgggcgcagcgtccgacctatcagagggcagaagaagactctctgac
gcggtgattggtggagcagctctctccaagttccaggccatgatggaggctcagggcgtg
gccaaagagacagctgaggagctttgctccgcccacactgattacttcaaagtcttcagg
aaatcggagcatcagatggagctgacggctgcagcagatggcatcgtctgcgacatcgac
gggatggtcgtagctcaggttctccataaattaggcgcaggacgatccatggctggggat
cctgtcaatcacagcgtgggggcggagctgctggtgtcactggatcagagagtccggaca
ggcagtccctggcttcggctccactacgaggatccggctccgagtccggatcagatccag
cagctgcagaaagctttgactgtgggaacccgaacccagcagaaccgcccgttggtggag
gaagtcctgttgtcctga

DBGET integrated database retrieval system