KEGG   Oryzias latipes (Japanese medaka): 101159668Help
Entry
101159668         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04218  Cellular senescence
ola04261  Adrenergic signaling in cardiomyocytes
ola04370  VEGF signaling pathway
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04933  AGE-RAGE signaling pathway in diabetic complications
ola05132  Salmonella infection
Module
ola_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101159668
   04370 VEGF signaling pathway
    101159668
   04068 FoxO signaling pathway
    101159668
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101159668
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101159668
   04621 NOD-like receptor signaling pathway
    101159668
   04622 RIG-I-like receptor signaling pathway
    101159668
   04625 C-type lectin receptor signaling pathway
    101159668
  Endocrine system
   04912 GnRH signaling pathway
    101159668
   04914 Progesterone-mediated oocyte maturation
    101159668
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101159668
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101159668
  Infectious diseases
   05132 Salmonella infection
    101159668
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101159668
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101159668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Kdo FTA2
Motif
Other DBs
NCBI-GeneID: 101159668
NCBI-ProteinID: XP_004069911
Position
6
AA seq 361 aa AA seqDB search
MSLRVRPGYSRQEVNKTSWEVPDRYRDLKQVGSGAYGTVCSATDSRTGAKVAIKKLYRPF
QSEIFAKRAYRELRLLKHMKHENVIGLLDVFTADLSLDRFLDFYLVMPFMGTDLGKLMKM
HKLSEDKIQYLVYQMLKGLKYIHSAGIIHRDLKPGNLGINQDCELKILDFGLARQTDSEM
TGYVVTRWYRAPEVILSWMHYTQTVDIWSVGCIMAEMLQGKPLFKGNDHLDQLTEIMKIT
GTPSPEFLSKLVSEEAKKYLKSLPKQEKKDLQKVFPSSDVHAVSMMEKMLLLDPEKRVTA
AEALTLPYFTEFRDSEEEKEAQPYDHSLDNAELSVDQWKRHTFTEILTFKPVLPDSKETS
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgcgggtgagacccggttattcccggcaggaggtcaacaaaacgtcgtgggaa
gtaccggatcggtaccgggacctgaagcaggtgggctcgggagcgtacgggacggtgtgc
tcagcaacagactccagaactggagccaaggtggccatcaagaagctctacagacctttc
cagtcggagatcttcgccaagcgggcttacagggagctgaggctcctcaaacacatgaaa
catgagaacgtgatcggcctgctggacgtcttcactgcagacctctccttggacagattc
cttgacttttatctggtgatgccgttcatggggacggacctggggaagctgatgaagatg
cacaagctgtcggaggacaagattcagtatttggtgtatcagatgctcaaaggcttgaag
tatattcactcagctggtatcattcacagagatcttaagcctggaaatctcggcatcaac
caagattgtgaacttaagatcttggactttgggttagcgcggcagacagacagcgagatg
acggggtacgtggtgacccgctggtacagagcgccggaggtcatcctgagctggatgcac
tacactcagaccgtggacatttggtccgtgggctgcatcatggcagaaatgcttcaagga
aaacctctttttaagggcaacgatcacctggatcagctgactgagatcatgaagatcaca
ggaacaccaagtccagaatttttgtccaaacttgtctctgaagaagctaagaagtacctc
aaaagtctgccaaaacaggaaaagaaagaccttcagaaggtgtttccctcatctgatgta
cacgccgtctctatgatggagaagatgctattgctggatccagaaaaacgagtcacggcc
gctgaggcgctcacgctcccttacttcaccgagttcagggacagcgaggaggagaaggag
gcgcagccatacgaccactccctggacaacgcggagctttctgtggaccagtggaaacgt
cacacattcacagagatcttgaccttcaagcccgtcctgccggactccaaagaaacctct
ctttaa

DBGET integrated database retrieval system