KEGG   Oryzias latipes (Japanese medaka): 101159747Help
Entry
101159747         CDS       T02443                                 

Definition
mitogen-activated protein kinase 1-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Gap junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101159747
   04012 ErbB signaling pathway
    101159747
   04350 TGF-beta signaling pathway
    101159747
   04370 VEGF signaling pathway
    101159747
   04068 FoxO signaling pathway
    101159747
   04150 mTOR signaling pathway
    101159747
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101159747
  Cell growth and death
   04114 Oocyte meiosis
    101159747
  Cell communication
   04510 Focal adhesion
    101159747
   04520 Adherens junction
    101159747
   04540 Gap junction
    101159747
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101159747
   04621 NOD-like receptor signaling pathway
    101159747
  Endocrine system
   04910 Insulin signaling pathway
    101159747
   04912 GnRH signaling pathway
    101159747
   04914 Progesterone-mediated oocyte maturation
    101159747
   04916 Melanogenesis
    101159747
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101159747
   04270 Vascular smooth muscle contraction
    101159747
  Development
   04320 Dorso-ventral axis formation
    101159747
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101159747
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101159747
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   101159747
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101159747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 389 aa AA seqDB search
MADSCSTAAVGAEGSDSAAAAGAVGAVAQNEAGGSKPCSESVRGQNFDVGPRYTNLSYIG
EGAYGMVCSALDNLTNQRVAIKKISPFEHQTYCQRTLREIKILLRFNHENIIGINDILRA
RHIDNMRDVYIVQTLMETDLYKLLKSQRLSNDHVCYFLYQILRGLKYIHSANVLHRDLKP
SNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIW
SVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQEDLNSIINVKARNYLQSLPEKPK
VPLEKLFVKADPKALDLLGRMLTFNPVKRISVEDALAHPYLEQYYDPNDEPVAEEPFTFS
MELDDLPKETLKEMIYEETARFVKNYQGS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcggattcgtgcagcactgcagcggttggggccgagggctccgacagcgctgctgct
gccggggcggttggtgctgttgcgcagaatgaagccggagggtccaagccctgctcggag
tcggtgaggggccagaattttgacgttggcccccgctacacgaacctgtcttacatcggc
gaaggagcttatggaatggtctgctctgccctggataacttgacaaatcagcgcgtggcc
atcaagaaaatcagtccattcgagcaccagacgtactgccagcgcactctgagagaaatc
aagatcctgctgcgcttcaaccacgagaacatcatcgggattaacgacatcctgagggcg
cggcacattgataacatgagggatgtctacatcgtgcagaccctgatggagaccgatctg
tacaagctgctgaagagccagaggctaagcaacgaccacgtctgctacttcctctaccag
atcctgcgaggcctcaagtacatccactctgccaacgtgctgcaccgtgacctcaagccc
tccaacctgctcatcaacaccacctgcgacctcaagatctgtgacttcggcttggctcgg
atagctgatccagagcacgaccacaccggcttcttgactgagtatgtggccactcgttgg
tacagagctccggaaatcatgctcaactcaaagggttactccaagtctattgacatctgg
tcggtgggctgcatcttagctgaaatgctgtctaataagcctatattccctggaaagcac
tacttggaccagctcaaccacattctaggtgttcttggctctccatctcaagaagatctg
aacagcatcataaacgtcaaggccaggaactatttgcagtccctgcctgagaaaccgaag
gtccccctggagaagctctttgtcaaggcagatccaaaagctctggatctgttgggccgc
atgctgacctttaaccctgttaagcgcatcagcgttgaagacgcactggctcacccttac
ctggagcaatactatgaccccaatgatgagcctgtagcagaggagcctttcacgttctcc
atggaactggatgatctgcccaaggagacgctgaaggaaatgatctatgaagaaactgct
cgtttcgtgaaaaactaccagggatcatga

DBGET integrated database retrieval system