KEGG   Oryzias latipes (Japanese medaka): 101159781Help
Entry
101159781         CDS       T02443                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101159781
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101159781
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101159781
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101159781
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     101159781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 381 aa AA seqDB search
MLKSLTSACRLRSIHRLQRIQAHMMSSHGEPEVLLDKVGRAGVITMNRPKVLNALNLTMI
RQILPQLKKWENDAETDIVIIKGAGGKAFCAGGDIRAVTEAGKVGDSLAQDFFREEYTLN
NTIGSFKKPYIAFIGGITMGGGVGLSVHGRFRVATEKTLFAMPETAIGLFPDVGGGYFLP
RLQGKLGLFLALTGFRLKGRDVQRAGVATHFVDSVKIPDLENELVDLKSPSDAEITKVLD
SYQNQSSIDSDKPFVLDKHLHNIDRLFSASSMEGIMQNLKADGSEFAKKQAEVLSKMSPT
SLKITYRQLQAGATLSLQEVLVMEYRLSQACMRGCDFYEGVRAVLVDKDQSPKWNPSTLE
EVSEQSVDECFSSLGEKDLTL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtctctaacgtctgcctgcagactgaggtccattcacagactgcaacgaatt
caggcacatatgatgtcaagtcatggagaacctgaggttctgctggacaaagtgggcagg
gctggtgtgattacaatgaacagacctaaagttctcaatgcacttaacctgacaatgatc
aggcaaattttgccacaactcaagaaatgggaaaatgatgctgaaacggacattgtgatc
attaaaggagcaggtgggaaagccttttgtgctggcggagacattagagcggtaacagaa
gcggggaaggttggtgactctcttgctcaggacttttttcgggaggaatatactctaaat
aacaccataggatcattcaagaagccatatattgcttttattggtggcataacaatggga
gggggtgtgggtctgtcagttcatggacgctttcgagtggcaactgagaagactctgttt
gcgatgccagagaccgccatcggactttttcctgatgtaggaggaggatattttctcccc
aggcttcaaggaaagcttggactgttcctcgccttgacgggcttccggctcaaaggacgg
gacgtgcagagagctggagttgccactcactttgtagattctgtgaagatcccagacctg
gagaatgaactagtggatttgaaatctccctctgatgctgaaatcaccaaagtgcttgac
tcctaccagaaccagagtagtatagactctgacaagccttttgttttggacaaacacctt
cacaatatcgacaggctgttcagcgccagcagcatggaaggaatcatgcagaacctgaag
gcagatggttccgaatttgctaagaaacaagccgaggtcctgtctaaaatgtctcccaca
tccctaaagatcacatacagacagctgcaggccggtgcaactctgagcctgcaggaggtg
ttggtgatggagtatcgattgagccaggcctgcatgagaggctgtgatttctatgaaggt
gttcgagctgtgctggttgacaaagaccagagtcccaagtggaatccatcaaccctggag
gaggtgtctgagcagagtgtggacgagtgtttttcctctttaggagagaaggacctgact
ttgtga

DBGET integrated database retrieval system