KEGG   Oryzias latipes (Japanese medaka): 101159781Help
Entry
101159781         CDS       T02443                                 

Gene name
hibch
Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101159781 (hibch)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101159781 (hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101159781 (hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101159781 (hibch)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     101159781 (hibch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 381 aa AA seqDB search
MLKSLTSACRLRSIHRLQRIQAHMMSSHGEPEVLLDKVGRAGVITMNRPKVLNALNLTMI
RQILPQLKKWENDAETDIVIIKGAGGKAFCAGGDIRAVTEAGKVGDSLAQDFFREEYTLN
NTIGSFKKPYIAFIGGITMGGGVGLSVHGRFRVATEKTLFAMPETAIGLFPDVGGGYFLP
RLQGKLGLFLALTGFRLKGRDVQRAGVATHFVDSVKIPDLENELVDLKSPSDAEITKVLD
SYQNQSSIDSDKPFVLDKHLHNIDRLFSASSMEGIMQNLKADGSEFAKKQAEVLSKMSPT
SLKITYRQLQAGATLSLQEVLVMEYRLSQACMRGCDFYEGVRAVLVDKDQSPKWNPSTLE
EVSEQSVDECFSSLGEKDLTL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtctctaacgtctgcctgcagactgaggtccattcacagactgcaacgaatt
caggcacatatgatgtcaagtcatggagaacctgaggttctgctggacaaagtgggcagg
gctggtgtgattacaatgaacagacctaaagttctcaatgcacttaacctgacaatgatc
aggcaaattttgccacaactcaagaaatgggaaaatgatgctgaaacggacattgtgatc
attaaaggagcaggtgggaaagccttttgtgctggcggagacattagagcggtaacagaa
gcggggaaggttggtgactctcttgctcaggacttttttcgggaggaatatactctaaat
aacaccataggatcattcaagaagccatatattgcttttattggtggcataacaatggga
gggggtgtgggtctgtcagttcatggacgctttcgagtggcaactgagaagactctgttt
gcgatgccagagaccgccatcggactttttcctgatgtaggaggaggatattttctcccc
aggcttcaaggaaagcttggactgttcctcgccttgacgggcttccggctcaaaggacgg
gacgtgcagagagctggagttgccactcactttgtagattctgtgaagatcccagacctg
gagaatgaactagtggatttgaaatctccctctgatgctgaaatcaccaaagtgcttgac
tcctaccagaaccagagtagtatagactctgacaagccttttgttttggacaaacacctt
cacaatatcgacaggctgttcagcgccagcagcatggaaggaatcatgcagaacctgaag
gcagatggttccgaatttgctaagaaacaagccgaggtcctgtctaaaatgtctcccaca
tccctaaagatcacatacagacagctgcaggccggtgcaactctgagcctgcaggaggtg
ttggtgatggagtatcgattgagccaggcctgcatgagaggctgtgatttctatgaaggt
gttcgagctgtgctggttgacaaagaccagagtcccaagtggaatccatcaaccctggag
gaggtgtctgagcagagtgtggacgagtgtttttcctctttaggagagaaggacctgact
ttgtga

DBGET integrated database retrieval system