KEGG   Oryzias latipes (Japanese medaka): 101159949Help
Entry
101159949         CDS       T02443                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ola  Oryzias latipes (Japanese medaka)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 262 aa AA seqDB search
MGSAPYPAGEWREKGRGGLQELGCMPWKVNKQKGGGGGGEGAGAERRHGDYRDVQQRDLS
SSSSSLTPPAPPRPPPAIYHEKQRRELCALHALNNVFQDGTAFSRDALQEIYQRLSPSTM
VTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGSIELSNVEGFILNVPSNLRW
GPLRLPLKRQHWIGVKEVGGVYYNLDSKLRNPQPIGSPDELRKFLRQQLRGKNCELLWCA
RESDCVPHPVPTLLNMTRDRLR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgctccgtacccagccggtgagtggagggagaaagggcgaggcggcctgcag
gagctgggctgcatgccgtggaaagtcaacaagcagaaaggaggaggaggaggaggagag
ggggcgggggcagagaggaggcacggggattacagggacgttcagcagcgggatctctca
tcctcctcttcctcacttacaccccctgctcctccccgacctcccccggcgatttaccac
gagaagcagcggcgagagctgtgcgctctgcacgcgctcaacaacgtcttccaggacggg
acggccttcagtcgggacgccctgcaggagatataccaaaggctttctcccagcaccatg
gtgacgcctcacaaaaagagcatgctgggaaacgggaactacgacgtcaacgtcatcatg
gctgccctgcagacccgagggttcgaggccgtttggtgggataaaagaagggacgtcggc
agcatcgagttgtccaacgtggaaggtttcatcctgaacgtaccgtccaacctccgctgg
gggccccttcgcctgccgctcaagcgccagcactggatcggggtcaaagaggtgggcgga
gtctattacaacctggactccaagctacgcaaccctcagcccatcgggagcccggatgag
ctcaggaagtttctgcgccagcagctgcgagggaaaaactgtgaactcctttggtgtgca
cgagagagtgattgtgtgccgcaccctgtcccaactttgctcaacatgacccgggatagg
ctacggtga

DBGET integrated database retrieval system