KEGG   Oryzias latipes (Japanese medaka): 101160262Help
Entry
101160262         CDS       T02443                                 

Gene name
sphk2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101160262 (sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101160262 (sphk2)
   04020 Calcium signaling pathway
    101160262 (sphk2)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     101160262 (sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 886 aa AA seqDB search
MRSPEPSSSPPAEALLHGQFASWGSGTNSNSNSRPSSPGGLGGLSPAASPTSPPVSNYAL
TLTHSHIHIQRLSPKSGKEARLLLPLSELVGCSCPRSPAPPLFVLYWYPPGKRRKGVSRR
RQVRAYLAESRPEAERWSAAVQCLLRGVTVTADTEFSRSLLPRPRRLLLLVNPFSGRGQA
MQWCQTHILPMIREANISYNLIQTERQNHARELIREVSLSDWDGIVIVSGDGLLHEVING
LMERPDWEQAIKTPVGILPCGSGNALAGSINHNAGYDMCLREPLLLNCCFLLCRGGVRPM
DVVSVTTSPAPSNNSHPAAPRRVFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLVRI
ASLRSYKGRLSFLPPSVVPSSSDGTTPPPRRPLSRSITEGLEGFCRLPIHRTCSDMGISE
QRSLRRGEGEREKEERQRERERRRERARGGGTGVVRASSLAEDREKEGELEAEDDKSRTC
SERSGTSSESNEMNKERLEKIEDEGTFGQESVEMEEDRGQDGGGSGDSVEEEEALAAREL
DEGYGVDMGQEADEETEESITYPDDPQRARQGVRKNSAPSSEICNDLSSQPLHKVADADS
STADGVEDIDLNGTYFQKDPYTDVARERSLTISSPFRHSPFSFKHKALDQNQNASRPRPL
SLLQHSHTNSLPPKMPSLSLSPTPPPSPSCASPHSSYYLNPRPNTPNSSSPSPSVRTPSS
SFNFDISEAARPFKNRPLVTLPPDLPRDNLLPPLDQPLPTRDWVTIEGDFVLVLALYQTH
LGADLHAAPQAKFDDGLIHLTFVRAGISRATLLRLFFAMERGTHHSVSSPYVSHVTCKAF
RLQPLSAKGTLTVDGELVPYGPLQAQVHPSMARLIVGDYGVKITSF
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcccctgaaccgtcctcgtcgcctccagcagaagccctgcttcatggccagttt
gctagctgggggtcaggcaccaacagcaacagtaacagccgtcccagcagccccggcggc
ctcggaggactttcccctgctgcatccccaacatctcctccagtgtccaactatgccttg
actctcacgcacagccacattcacattcagaggctgtccccaaagtcagggaaggaagcc
cgactgctgctgcctctgtctgagctggtggggtgcagctgcccccgctcccctgcaccc
ccactgtttgtgttgtactggtaccccccagggaaacgaaggaaaggggtgtcccgtcgc
aggcaggtgagggcctatctagctgaaagcaggcctgaagctgaaaggtggtctgctgct
gtacagtgtctcctcagaggggtgactgttactgctgacaccgaattttcgagaagtctt
ctacctcgtcccaggcggctgctgttattggtgaatccattcagtggaaggggccaagca
atgcaatggtgtcagacccacatcctgccaatgattagagaggccaatatcagctacaac
ctcatacagactgaacggcagaatcatgcaagagagctcatcagagaagtgtccctctct
gactgggatggcatcgtcattgtctctggagatggcttgttgcatgaggtaattaatggt
ttaatggagcgtccagactgggaacaagcaataaaaacacctgtcggcattctgccctgc
ggttccgggaatgcgctggctggttccatcaatcacaacgcagggtatgacatgtgcctt
cgagagcccctcctattgaactgctgctttctgctatgtcgaggcggggtgcgaccgatg
gacgtggtctccgtgacaacgagccctgctccgtccaacaacagtcatcctgcagcaccc
aggagagtcttttcctttctttctgttgcctggggctttgtgtctgatgtagacattgaa
agtgagagatatcgtggcttgggctcagcccgcttcaccctgggcactttagttcgcata
gcttcgctccgatcctacaaaggccgcctgtcctttctgcctccctctgtcgtcccttca
tcctcagatggcacgacccccccgccgaggagacccctgtcccgcagcatcactgaaggc
ctggaggggttttgccgattgcccatacaccgcacctgctctgacatgggcatcagcgag
caaagaagtctgcggaggggtgaaggagaaagggaaaaggaggagaggcagagggaaagg
gagaggagaagggagagggccagagggggaggaactggtgtggtgagggcgagcagcctt
gcggaggacagggaaaaggagggggagctggaggcagaggatgacaagtcaaggacttgt
tcagaaaggtccgggacaagttctgaatcgaatgaaatgaataaagaaaggttggagaaa
attgaagacgagggaacatttggacaagagtctgttgagatggaggaggatagagggcag
gatggaggagggagtggcgactctgttgaagaagaggaagcgttagccgcaagagagcta
gatgagggctacggggtggacatggggcaagaggcggatgaagaaacagaggagtccatc
acttacccagacgaccctcagcgtgccagacagggcgttaggaagaattcagccccgtcc
agtgagatctgtaacgacctgtcgagtcagcctctgcataaggtggctgacgcagattca
agcacagcagatggggtggaggacatagatctgaatggaacctacttccagaaagatcct
tacacagatgtggctcgggagcgatctctgaccatctcctctccttttcgtcattctccc
ttttctttcaagcataaagccctggaccaaaaccaaaacgcttcccgtccaagacctctg
tcactcctgcagcactcccacactaactctctcccccctaaaatgccttccctttcactg
tctcctactcccccgccctccccctcttgcgcctctccacactcatcctattaccttaac
cctcgtccaaacacgccaaattcctcctcgccctctccgtctgtccgcacaccgtcctca
tctttcaactttgacatttccgaagcagccagacccttcaagaaccgcccgttggtcacg
ttgcctccagatctaccgagagacaacttgttaccccctcttgaccaacccctccccact
agagactgggtgaccatcgaaggggactttgtgttggtcttggccctttatcaaacccac
ctgggagctgaccttcacgccgcacctcaagccaagtttgacgacgggctcattcacctg
acatttgtgcgggcaggaatctccagagccacgctactaagattgttctttgccatggag
agaggaacccaccactccgtcagctcgccgtacgtgagccacgttacctgcaaggccttc
aggctgcaacctctatctgcaaaaggaacgctcaccgtcgatggagaacttgttccttat
gggccactccaggcacaggttcatccttccatggctcgtctcattgttggagactacgga
gtgaagattaccagcttttaa

DBGET integrated database retrieval system