KEGG   Oryzias latipes (Japanese medaka): 101160262Help
Entry
101160262         CDS       T02443                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ola00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ola04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ola04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 876 aa AA seqDB search
MRSPEPSSSPPAEALLHGQFASWGSGTNSNSNSRPSSPGGLGGLSPAASPTSPPVSNYAL
TLTHSHIHIQRLSPKSGKEARLLLPLSELVGCSCPRSPAPPLFVLYWYPPGKRRKGVSRR
RQVRAYLAESRPEAERWSAAVQCLLRGVTVTADTEFSRSLLPRPRRLLLLVNPFSGRGQA
MQWCQTHILPMIREANISYNLIQTERQNHARELIREVSLSDWDGIVIVSGDGLLHEVING
LMERPDWEQAIKTPVGILPCGSGNALAGSINHNAGYDMCLREPLLLNCCFLLCRGGVRPM
DVVSVTTSPAPRVFSFLSVAWGFVSDVDIESERYRGLGSARFTLGTLVRIASLRSYKGRL
SFLPPSVVPSSSDGTTPPPRRPLSRSITEGLEGFCRLPIHRTCSDMGISEQRSLRRGEGE
REKEERQRERERRRERARGGGTGVVRASSLAEDREKEGELEAEDDKSRTCSERSGTSSES
NEMNKERLEKIEDEGTFGQESVEMEEDRGQDGGGSGDSVEEEEALAARELDEGYGVDMGQ
EADEETEESITYPDDPQRARQGVRKNSAPSSEICNDLSSQPLHKVADADSSTADGVEDID
LNGTYFQKDPYTDVARERSLTISSPFRHSPFSFKHKALDQNQNASRPRPLSLLQHSHTNS
LPPKMPSLSLSPTPPPSPSCASPHSSYYLNPRPNTPNSSSPSPSVRTPSSSFNFDISEAA
RPFKNRPLVTLPPDLPRDNLLPPLDQPLPTRDWVTIEGDFVLVLALYQTHLGADLHAAPQ
AKFDDGLIHLTFVRAGISRATLLRLFFAMERGTHHSVSSPYVSHVTCKAFRLQPLSAKGT
LTVDGELVPYGPLQAQVHPSMARLIVGDYGVKITSF
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcccctgaaccgtcctcgtcgcctccagcagaagccctgcttcatggccagttt
gctagctgggggtcaggcaccaacagcaacagtaacagccgtcccagcagccccggcggc
ctcggaggactttcccctgctgcatccccaacatctcctccagtgtccaactatgccttg
actctcacgcacagccacattcacattcagaggctgtccccaaagtcagggaaggaagcc
cgactgctgctgcctctgtctgagctggtggggtgcagctgcccccgctcccctgcaccc
ccactgtttgtgttgtactggtaccccccagggaaacgaaggaaaggggtgtcccgtcgc
aggcaggtgagggcctatctagctgaaagcaggcctgaagctgaaaggtggtctgctgct
gtacagtgtctcctcagaggggtgactgttactgctgacaccgaattttcgagaagtctt
ctacctcgtcccaggcggctgctgttattggtgaatccattcagtggaaggggccaagca
atgcaatggtgtcagacccacatcctgccaatgattagagaggccaatatcagctacaac
ctcatacagactgaacggcagaatcatgcaagagagctcatcagagaagtgtccctctct
gactgggatggcatcgtcattgtctctggagatggcttgttgcatgaggtaattaatggt
ttaatggagcgtccagactgggaacaagcaataaaaacacctgtcggcattctgccctgc
ggttccgggaatgcgctggctggttccatcaatcacaacgcagggtatgacatgtgcctt
cgagagcccctcctattgaactgctgctttctgctatgtcgaggcggggtgcgaccgatg
gacgtggtctccgtgacaacgagccctgctccgagagtcttttcctttctttctgttgcc
tggggctttgtgtctgatgtagacattgaaagtgagagatatcgtggcttgggctcagcc
cgcttcaccctgggcactttagttcgcatagcttcgctccgatcctacaaaggccgcctg
tcctttctgcctccctctgtcgtcccttcatcctcagatggcacgacccccccgccgagg
agacccctgtcccgcagcatcactgaaggcctggaggggttttgccgattgcccatacac
cgcacctgctctgacatgggcatcagcgagcaaagaagtctgcggaggggtgaaggagaa
agggaaaaggaggagaggcagagggaaagggagaggagaagggagagggccagaggggga
ggaactggtgtggtgagggcgagcagccttgcggaggacagggaaaaggagggggagctg
gaggcagaggatgacaagtcaaggacttgttcagaaaggtccgggacaagttctgaatcg
aatgaaatgaataaagaaaggttggagaaaattgaagacgagggaacatttggacaagag
tctgttgagatggaggaggatagagggcaggatggaggagggagtggcgactctgttgaa
gaagaggaagcgttagccgcaagagagctagatgagggctacggggtggacatggggcaa
gaggcggatgaagaaacagaggagtccatcacttacccagacgaccctcagcgtgccaga
cagggcgttaggaagaattcagccccgtccagtgagatctgtaacgacctgtcgagtcag
cctctgcataaggtggctgacgcagattcaagcacagcagatggggtggaggacatagat
ctgaatggaacctacttccagaaagatccttacacagatgtggctcgggagcgatctctg
accatctcctctccttttcgtcattctcccttttctttcaagcataaagccctggaccaa
aaccaaaacgcttcccgtccaagacctctgtcactcctgcagcactcccacactaactct
ctcccccctaaaatgccttccctttcactgtctcctactcccccgccctccccctcttgc
gcctctccacactcatcctattaccttaaccctcgtccaaacacgccaaattcctcctcg
ccctctccgtctgtccgcacaccgtcctcatctttcaactttgacatttccgaagcagcc
agacccttcaagaaccgcccgttggtcacgttgcctccagatctaccgagagacaacttg
ttaccccctcttgaccaacccctccccactagagactgggtgaccatcgaaggggacttt
gtgttggtcttggccctttatcaaacccacctgggagctgaccttcacgccgcacctcaa
gccaagtttgacgacgggctcattcacctgacatttgtgcgggcaggaatctccagagcc
acgctactaagattgttctttgccatggagagaggaacccaccactccgtcagctcgccg
tacgtgagccacgttacctgcaaggccttcaggctgcaacctctatctgcaaaaggaacg
ctcaccgtcgatggagaacttgttccttatgggccactccaggcacaggttcatccttcc
atggctcgtctcattgttggagactacggagtgaagattaccagcttttaa

DBGET integrated database retrieval system