KEGG   Oryzias latipes (Japanese medaka): 101160322Help
Entry
101160322         CDS       T02443                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101160322
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101160322
   04020 Calcium signaling pathway
    101160322
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     101160322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 560 aa AA seqDB search
MEKAASDADPSRQRNGFVGALYGEFTDTLDDRVRYSVSLTESALTIQKISALPGQTKVVF
NLSDCVGCRARSGPDSADVGAYFTAYFYPFKRRWMSAGLTRQRVEQCFRVALVQDPLVNL
QEAERWARAIRDASALQAPRRDGVVYTELQRPCRTMILVNPHSGRGQALQLFTGHVQGML
TEASVPYTLVITEHQNHARELVKKADLSQWDALVIMSGDGLLYEVINGLMEREDWQEAIQ
TPLGILPGGSGNALAASVHHYSQLPPAWNEELLLSCGFMLCKGLVCSLDLVSIHLTSRQR
LFSFLSLAWGFVADVDIESEKYRHVGAIRFLMGTLVRLAALRVYQGRLAYLPAKDAPKKD
KASTKVNCSNTPQQGLFCSSLSCSLVPNTSSKQSQKCTNSNSNTITNSSNQAASKNKSEG
QSNARTETLVDSLLPDLDQPVPEAWTVVKEQDFVLVLAVYQSHLAEDLWAAPSAMVNDGL
IHLIYVTAGISRPALLRLFLAMEKGAHLECGCPHLVYQKVRALRLEPISAEGVITVDGET
VEYGPVQAQIQPGLARLISG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagccgcctcagacgcggacccatcccgacagcggaacgggttcgtgggcgcg
ctgtacggagagttcacggacacgctcgacgacagggtccgatactctgtgagcctgacg
gagagcgcgctcaccatccagaagatctcggcgctacctggacagactaaggtggtgttc
aacttgagcgactgtgtgggctgtcgcgcgcgcagtgggccggacagcgcggacgtcggc
gcctacttcactgcttatttttacccgttcaagaggcgctggatgagcgccgggctgacc
cgccagagagtggagcagtgctttcgggtcgcgctggtccaggacccgctggtcaacctg
caggaggctgagaggtgggctcgtgccatcagagatgcttcagcgctgcaagctccacgg
agagatggtgtggtctacacggagctgcaaaggccttgcagaaccatgatcctggtgaac
ccccacagcgggcggggacaggcgctgcagctcttcactggtcacgtacagggcatgctc
acagaggcatctgttccctacacacttgtcatcacagagcaccaaaaccacgcgcgagag
ctggtgaagaaggctgacctgtcacagtgggacgcactggtgatcatgtccggggatggc
ctgctttatgaggtgataaatggtctgatggagcgagaggactggcaggaagccatccag
acccctctgggcatcctacctggcggctccggcaacgctctggctgcatccgtccaccac
tattcacagttgcctcctgcatggaatgaggagctgctcctgagctgtgggttcatgctg
tgcaaaggtctggtttgttctctggacctagtgtcgatccacttgacttccagacagcgc
ctcttctccttcctgtccttggcttggggctttgtggcggatgtcgacatcgagagtgag
aagtaccgtcacgtgggagctatccgctttctgatgggcaccctggtgcgactggccgcc
ctcagggtataccagggccggctggcctatctccctgcgaaggacgcacccaaaaaagac
aaagcaagcacaaaggtgaattgctcaaacacacctcagcagggcttgttctgctcttcc
ctgtcctgttcactcgtacccaacacttcgtctaagcagagtcagaaatgcacaaactcg
aactccaacaccatcactaactcctccaaccaggctgcgagtaaaaacaaatctgagggg
caaagcaatgctcgaactgaaaccctggtggactccctccttcctgaccttgatcaacct
gtcccagaagcttggactgttgtaaaagaacaagactttgtgctggtgctggctgtttat
cagtcacaccttgctgaggacctgtgggcggctcctagtgccatggtaaacgatggattg
attcatctgatctacgtgaccgcaggaatatcccggccagctctcttacgcctcttcctc
gctatggagaagggcgcacacttggagtgcggctgccctcacctggtctaccagaaggtc
agggccctgcgactggagcccatctctgcagagggcgtgattaccgtagatggagagacg
gtggagtacggacctgttcaggctcaaatccaaccaggactagccagactcataagtgga
tga

DBGET integrated database retrieval system