KEGG   Oryzias latipes (Japanese medaka): 101160547Help
Entry
101160547         CDS       T02443                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ola00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:ola03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 510 aa AA seqDB search
MRAWQLGFLFVVVSNAAVQHVMSLEGEELADSTFGNFLDPLKDLFEPEDDKNSTIARFSL
RKPSHPDDDLCFIIPGQPESLTACTFNRTSKTFLLIHGWTLSGMYGSWMPKLVSALFEKE
QSANVIVVDWLSLAQNHYAVAAQNTKAVGQEIARFIDWIEETTNIPLDNIHLIGYSLGAH
VAGFAGSHAANKVGRITGLDPAGPDFEGEHAHRRLSPDDAHFVDVLHTFTRGSLGFSIGI
QQPVGHVDIYPNGGHFQPGCNLRGALEKIANFGILAVTDAVKCEHERSIHLFIDSLLNEQ
DAVTAYRCGSSDTFDRGMCLNCRKNRCNTVGYGVSKVRRARSVQMYTKTRSSMPFRVYHY
QLKIHFSSKVNTSDVQPSLSVSLYGTKGDAEDLELRLEERLLTNKTHSFLLVTEKDIGDL
LMLKFKWEEPSTWTASSLLKMVSSWWSGDSNGGMEVHKIRIRAGETQKRMVFCVKEPQGF
SQEVTFVKCKDAWRMNRKKTERGTVEIRSP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgtggcagcttggcttcttgttcgtcgtggtgtcaaacgcagctgtgcagcat
gtgatgtccttggaaggagaggagctcgcagattccacgtttggtaactttcttgaccct
ctgaaagacttgtttgaacctgaggatgacaaaaactcgacaattgccagattctccctc
cgtaaaccctcccaccccgacgatgacctctgcttcatcattcctggccaaccggagtcc
ctgacggcctgcaccttcaacagaacttccaagaccttccttttgatccacggatggaca
ctgagtggaatgtatggaagctggatgccgaagctggtctccgctctgtttgagaaagag
cagagcgccaacgtcatcgtggtggactggctcagcttggctcagaaccactacgccgtg
gcggcacagaacaccaaagcggtgggacaggagatcgctcgattcatcgactggatcgag
gaaaccaccaacattcctttagacaacatccacctgatcggctacagcctcggcgctcac
gtggccggatttgccggcagccatgctgccaataaagttgggagaataaccgggctcgat
ccagccggacccgactttgagggcgaacacgctcacaggcggctgtctccggacgacgct
cactttgtggatgtcctccacactttcacacgaggttctctggggttcagcatcgggatc
cagcagcctgtcggccatgtggacatttacccaaatggcggccacttccagccgggctgc
aacctcaggggggctctggagaaaatagctaactttgggattcttgccgtcaccgatgcg
gtgaagtgtgaacacgagcgctccatccatctgttcatcgactcccttctgaacgagcag
gacgccgtcacggcctacaggtgcggcagcagcgacaccttcgaccgcggcatgtgtctc
aactgccgcaagaaccggtgcaacacggtgggctacggggtcagcaaggtccgcagggcg
cgaagcgtgcagatgtacaccaagacacggagctccatgcctttcagagtttatcattac
cagctgaagatccacttctccagtaaggtgaatacttccgatgtgcagccttctctgtcc
gtgtcgctgtatggaaccaaaggagatgctgaggacctggagctgaggctagaggagaga
ctgctgacaaacaagactcactcctttctgctggtgacagaaaaagacatcggcgacctg
ctgatgctgaagtttaagtgggaggagccaagcacctggactgcttccagcctactgaag
atggtttcttcgtggtggtccggggactcaaacggtggcatggaggtccacaaaattcga
atccgagccggcgagacgcagaaaaggatggtgttctgtgtaaaagagcctcagggtttt
tctcaggaggtcacctttgtcaaatgtaaagacgcctggaggatgaaccggaaaaaaacg
gagagaggaaccgtggagatccgctcaccgtga

DBGET integrated database retrieval system