KEGG   Oryzias latipes (Japanese medaka): 101160547Help
Entry
101160547         CDS       T02443                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101160547
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101160547
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101160547
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101160547
  Exosomal proteins of breast milk
   101160547
Heparan sulfate/heparin binding proteins [BR:ola00536]
 Enzymes (General comment) Variety
  101160547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 510 aa AA seqDB search
MRAWQLGFLFVVVSNAAVQHVMSLEGEELADSTFGNFLDPLKDLFEPEDDKNSTIARFSL
RKPSHPDDDLCFIIPGQPESLTACTFNRTSKTFLLIHGWTLSGMYGSWMPKLVSALFEKE
QSANVIVVDWLSLAQNHYAVAAQNTKAVGQEIARFIDWIEETTNIPLDNIHLIGYSLGAH
VAGFAGSHAANKVGRITGLDPAGPDFEGEHAHRRLSPDDAHFVDVLHTFTRGSLGFSIGI
QQPVGHVDIYPNGGHFQPGCNLRGALEKIANFGILAVTDAVKCEHERSIHLFIDSLLNEQ
DAVTAYRCGSSDTFDRGMCLNCRKNRCNTVGYGVSKVRRARSVQMYTKTRSSMPFRVYHY
QLKIHFSSKVNTSDVQPSLSVSLYGTKGDAEDLELRLEERLLTNKTHSFLLVTEKDIGDL
LMLKFKWEEPSTWTASSLLKMVSSWWSGDSNGGMEVHKIRIRAGETQKRMVFCVKEPQGF
SQEVTFVKCKDAWRMNRKKTERGTVEIRSP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgtggcagcttggcttcttgttcgtcgtggtgtcaaacgcagctgtgcagcat
gtgatgtccttggaaggagaggagctcgcagattccacgtttggtaactttcttgaccct
ctgaaagacttgtttgaacctgaggatgacaaaaactcgacaattgccagattctccctc
cgtaaaccctcccaccccgacgatgacctctgcttcatcattcctggccaaccggagtcc
ctgacggcctgcaccttcaacagaacttccaagaccttccttttgatccacggatggaca
ctgagtggaatgtatggaagctggatgccgaagctggtctccgctctgtttgagaaagag
cagagcgccaacgtcatcgtggtggactggctcagcttggctcagaaccactacgccgtg
gcggcacagaacaccaaagcggtgggacaggagatcgctcgattcatcgactggatcgag
gaaaccaccaacattcctttagacaacatccacctgatcggctacagcctcggcgctcac
gtggccggatttgccggcagccatgctgccaataaagttgggagaataaccgggctcgat
ccagccggacccgactttgagggcgaacacgctcacaggcggctgtctccggacgacgct
cactttgtggatgtcctccacactttcacacgaggttctctggggttcagcatcgggatc
cagcagcctgtcggccatgtggacatttacccaaatggcggccacttccagccgggctgc
aacctcaggggggctctggagaaaatagctaactttgggattcttgccgtcaccgatgcg
gtgaagtgtgaacacgagcgctccatccatctgttcatcgactcccttctgaacgagcag
gacgccgtcacggcctacaggtgcggcagcagcgacaccttcgaccgcggcatgtgtctc
aactgccgcaagaaccggtgcaacacggtgggctacggggtcagcaaggtccgcagggcg
cgaagcgtgcagatgtacaccaagacacggagctccatgcctttcagagtttatcattac
cagctgaagatccacttctccagtaaggtgaatacttccgatgtgcagccttctctgtcc
gtgtcgctgtatggaaccaaaggagatgctgaggacctggagctgaggctagaggagaga
ctgctgacaaacaagactcactcctttctgctggtgacagaaaaagacatcggcgacctg
ctgatgctgaagtttaagtgggaggagccaagcacctggactgcttccagcctactgaag
atggtttcttcgtggtggtccggggactcaaacggtggcatggaggtccacaaaattcga
atccgagccggcgagacgcagaaaaggatggtgttctgtgtaaaagagcctcagggtttt
tctcaggaggtcacctttgtcaaatgtaaagacgcctggaggatgaaccggaaaaaaacg
gagagaggaaccgtggagatccgctcaccgtga

DBGET integrated database retrieval system