KEGG   Oryzias latipes (Japanese medaka): 101160599Help
Entry
101160599         CDS       T02443                                 

Definition
acyl-CoA desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101160599
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101160599
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101160599
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101160599
Lipid biosynthesis proteins [BR:ola01004]
 Desaturase
  First
   101160599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 333 aa AA seqDB search
MTEADALELKQHNSSNGDVCSEQTREDVFDNAYKEKEGPKPRRMIVWRNVILMTLLHIGA
TYGILLIPSVSPLTLLWSVLCFFISALGITAGAHRLWSHRSYKASLPLRIFLGFANSMAF
QNDIFEWARDHRVHHKYSETDADPHNAKRGFFFAHIGWLLVRKHPDVIEKGRKLELRDLL
SDKVVMFQRRYYKLSVLLVCFFIPMFVPWYLWGESLWAAYFVPVLLRYTMVLNATWLVNS
AAHMWGNKPYDQNINPRENKFVTFSAIGEGYHNYHHTFPYDYATSEFGCQLNLTTCFIDL
MCFLGLAKDCKRVSRELVLARVQRTGDGSHRSG
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggcggatgcattggagctaaagcagcacaattcgagcaacggggatgtttgt
tcagagcagaccagagaagacgtgtttgacaacgcttacaaggagaaagagggccccaaa
cctcgcaggatgatcgtgtggagaaatgtcattctgatgactctgttgcacataggagcc
acgtacgggatcctcctcatcccctcagtttccccgctgaccttgctttggtctgtgctt
tgttttttcataagtgctctgggaatcacggcgggggctcaccgcctgtggagtcacaga
tcctacaaggcttccttacccctgaggatctttctgggttttgcaaactccatggcattt
cagaatgacatttttgaatgggctcgagaccacagagttcaccacaaatactcagagaca
gacgccgacccccacaacgccaaacggggcttcttctttgcccacattggctggctgctg
gtgcgcaaacatccagatgtcatagaaaaaggcaggaagctggagctcagagacttgctg
tctgacaaagtggtaatgtttcagaggaggtattataagctctccgtgctgctcgtgtgc
ttcttcattccgatgttcgtaccgtggtacctgtggggggagtccctgtgggcggcgtac
ttcgtcccagtcctgctgaggtacaccatggtgctcaacgccacttggctggtcaacagc
gcagcccacatgtggggaaacaagccctacgaccagaacatcaacccccgagagaacaag
tttgtcactttcagcgccataggtgagggatatcacaactatcaccacaccttcccctac
gactatgccaccagcgagtttggctgccagctgaacctcacgacatgcttcatcgacctc
atgtgcttcctgggcctggccaaggactgcaagcgggtgtcccgcgagttggtcctggct
cgcgttcagcgcaccggagacgggagccaccgcagtggctag

DBGET integrated database retrieval system