KEGG   Oryzias latipes (Japanese medaka): 101160669Help
Entry
101160669         CDS       T02443                                 

Definition
histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific-like
Orthology
K15588  
histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101160669
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101160669
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 2321 aa AA seqDB search
MHQVSSSSSSDLCMSVASLAENCHTASPFDLCSTPSSKFFTSPANPALQLSLASLAPLPH
GMHKAMACHFQDTQTDFQAQAMRIRASEVSVPEGSSRKKEGIVKSGRRGRPSGTTKLAGY
RTSTGRPIGTTRAAGFKTSPGRPLGTTKAAGYKVSPGRPPGSIKSLARLRKLEFGRNSAK
TLDLNNCSVPKELDLTSCDLPPFSYTMMEKRVLCEPSSKADKPRDKHDSMNQSYRAGLRV
GSVFGSTQPELRAHNGSTSYGNRCGVVKRGSAQATPAPLPPSSLKQTAFLGYGQPERPCC
YSPQRRPQHPSKSDLHPHHNIHCASPIDEDDEFEAPLVQLPPSPGDDDLEPFETLQDGSR
NGFSPGSPDSFDRCSPIPNGCLHFESTLFDSSDVKEEDEGRQGGEDLTPFHHPSNSNQDR
TATKCKTTWSSGVDRIPYKPTVFNLMSKTISELNPTLSPSALPEITLRDGWNLGEELDSD
VELSSFDPGLISPAGTNSNSNSPKKKLLPAVRYSEGDLVWAKFNRRPWWPCRVIYDPDQG
FHTKMKVPSPRPCRMYFLETVGEVAERAWVPNGVILPFEGGHQFEDLPVLRRRGKQKEKD
YKYTIPKSLLTAWKVSVAEAELLLPGRQSNSALSVSTGEGERIPSPVSKEKEADDPSVSL
DLIQSPLPTEAPNGNEHQPLKNSSVQAKKIKTVKRKKKCLSDIFGHIVGGSKESAASVGS
QLNSSSRVLKEEPKDSPYADLDSVPMLHRPKRTPVSPEHDVGAFRLKEGSPTESKNSRVK
VKQILDLSHSSDGLRNQLPCKEGKSDHKSDGCAELLLRSDEKGTTPLPASNRLMRKALKA
KEETDQKDALAPNHIPTQTPPHPRTDATWTNAPIKTEMSENWDSPGNVFLPINHSSPKRR
TGKLEKKLVCNGSLIKSKRKDVSEQHFQSVKMEAESSQSEPSSASTSMSLSPEDAFPEGK
ELRFKSLAADNKVTDPSVFRPNSSYKFSTFLMLLKDIHDTREKEGNPLKIPPPPALIKEE
PLVIPTSADPLTGSGDGSTLRIMSENGQSGKSSVPQSTQRRAKSKTQTVPAANTYQCEDV
PLCTQSDKQRRKQRLPSKLKVRKPCPTADLANMAHGREFVSGHTDPLDPGSDPFAAPPDS
SASYLDGNSEISAAPKKRWQLVEGADERMASDASQLTGASPEAVPETEKHADSDSLSSAG
QSENKRLRKPTKRLLESTEEYEQMFSSKKRLKKHGSESSKMETLGMSTLHDFSAAEGFDT
SSSVDPAESQLEMRPSLSQDELSPVATSASPVSPQPSFDSEAAEKTDLPLGSDTAQIQER
KRPRKLSHKVLECTIEEVSAAPARRKEQKGLADITSDVKVLVKKTQFAAAAAAAAAGKKD
PVPSASPDSAVASKLPQRRSPTPQPCKSPKQEDETEPCSTEEKQTTHTGTLTPKPEVCVV
FAVLPTGLNDSFSSQVDGKGKTSSLKENVCQVCERPGDLLVCEGHCYGAFHLQCVGLSVA
PKGKFFCQECNTGDHMCFVCKKSGDVKRCIIPLCGKFYHMDCILAFSATQPHNKGFRCPL
HVCLSCHITNPVNVFSSKGRLARCVRCPVAYHANDNCMAAGSVVLDNNTFLCPNHFTPRK
GCKNHEHINVSWCFVCSEGGSLLCCEACPAAFHRECLNIEMPQGSWFCNDCKAGKKPRIK
DILWVKWGRYRWWPAEVCLARDVPNNILRMKHEVGEFPVQFFGSKDFVWTYQARVFPYME
GDTHNIEKMGKGADAIYKKALSEAAERFKELQTEREMKQLQEDRKNDKKPPPYRHIKVNR
PIGKVQIITADLSEVPRCNCKASDENPCGADSECINRMLMYECHPQVCAAGERCQNQAFT
KRQYTTVEIYRTLSCGWGLRAVSDIKKGAFVSEYVGEVIDEEECRARIRHAQEHDICNFY
MLTLDKDRVIDAGPKGNQARFMNHSCQPNCETQKWTVNGDTRVGLFALQDIAKGEELTFN
YNLECRGNGKTVCKCGAPNCSGFLGVRPKNQPPAEKVKLKEGKRRVGMKKKTKQQVMKER
EDECFSCGDGGQIVSCKKPGCPKVYHADCLNLAKRPAGRWECPWHQCDLCGKEAASFCEM
CPSSYCKEHREGMLFISKLDGKLSCSEHDPCGPDPLEPGEIREYMPSMASVRPGAVAAPV
LDARRASSSSSSSSSSSPYVPISYPDSQTAASKREPPPRLYINTKTATSSFIPSSSSYLA
DTTEETTTSSSASSKDEREDGEVEEGEVCALDMQEVEEDEEDEENDTEMLEEKEEEPIYG
GDLVEDEEGEDEDDPWGSCFDDDGEVEEEDFESWGKLEDEK
NT seq 6966 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaggtgagcagcagcagcagcagtgacctctgtatgagtgttgctagcctggca
gagaactgtcacacagccagcccctttgatttatgtagcacaccgtccagcaagttcttc
acctctcctgcaaaccctgctctacagctatctcttgccagccttgcccctctgcctcat
gggatgcacaaagccatggcttgtcattttcaagacacccagacagacttccaggcacag
gcaatgagaatcagggctagtgaggtctcggtgcctgagggatcatctaggaaaaaggag
ggaatagtcaaatcagggaggagagggagaccatcaggaaccacaaagttggcagggtat
cgcacaagcacaggacgcccaattggaacgactcgggcagctggattcaaaaccagccct
ggaagacccctcgggaccaccaaagccgctgggtataaagtcagccccggcaggcctccc
ggtagcatcaagagtctagctcgcctgaggaagttagagtttggccgtaacagcgccaaa
acgcttgacttgaacaactgcagcgttcccaaggaactggacttgacaagctgtgacctt
cctcctttttcatacaccatgatggagaagagggttctctgtgagccgagtagcaaagcg
gacaaacccagagacaagcatgacagcatgaatcagtcttacagagcgggtctgagggta
ggctcagtgtttggctcgacccagcctgagctgagggcccacaatggctccacttcctat
ggaaaccgctgtggcgtcgtgaagcgaggatctgcccaggcgacgcctgcaccgctgccg
ccttccagcctcaagcagaccgctttcctgggatacggccagccggagcgaccctgctgc
tacagcccgcagaggaggccccagcatccgagcaaatctgacctccatcctcaccacaac
attcactgcgcaagcccaatcgatgaggatgacgagtttgaggcgccgctggtccagctc
cctccttctccgggggacgacgacctggaaccttttgagaccttgcaggacgggagcagg
aacggcttctcccctggcagtccggacagctttgaccgctgctccccgatcccgaacgga
tgcctgcattttgagtccacgctgtttgacagcagtgacgttaaggaggaggatgagggt
cgccagggtggcgaggacctcacgcctttccaccacccctcaaactccaaccaggacaga
actgccacgaagtgtaaaaccacatggagctcaggggtggacagaataccatacaaaccc
acagtttttaatctgatgtccaaaactatttctgaactgaaccccacactcagccccagt
gctctgccagaaatcacactgagggacggctggaacctgggtgaggagttagacagtgat
gtggaactctcctcttttgaccctggacttatctcaccagctggcaccaactctaactcc
aacagcccaaagaaaaagcttctccctgcagtgagatactcggagggcgacttggtgtgg
gcgaaattcaacaggcggccctggtggccttgccgggtcatctatgaccccgatcagggc
tttcatactaagatgaaagttccgagcccccgtccatgtcggatgtatttcctggagact
gtcggggaggttgcagaacgggcctgggtcccaaacggcgtcattcttccctttgaagga
ggccatcagtttgaagaccttcctgtgcttagaagaagaggaaagcagaaggagaaggac
tacaagtacaccattcccaaaagcctgctgactgcgtggaaagtcagtgtggcagaggcg
gagctcctgctcccaggtcgacaaagtaactctgcactttcggtgtctacgggtgaagga
gaacgaataccaagccctgtttctaaggaaaaagaagccgatgacccctccgtctctctt
gacctcattcagtctcctttgcctactgaggctcctaatggtaatgagcaccaaccctta
aaaaattcttcagttcaggccaagaagatcaaaactgtcaagaggaaaaagaaatgtttg
tccgacatatttggccatatcgttggtggatcaaaggaatccgcggcgagtgttggcagc
cagctgaattcttcaagtcgtgtgctgaaagaggagcctaaggattcgccctatgctgat
ctggattcagttccaatgctgcatcgtccaaaacgcaccccagtttctccagaacacgac
gtcggcgcatttaggttgaaggagggcagtccaactgaatcaaaaaactctagagtcaag
gtgaagcagattttagatctgtcccattcttccgacggccttagaaatcagttgccgtgt
aaagaaggaaaatctgaccataaatctgacggctgcgctgaactgttgctcaggtcggat
gaaaaaggcaccacgcctcttcctgccagcaaccgcctgatgagaaaagctctgaaagca
aaggaagagactgatcagaaagatgcactagctccaaatcatatcccaacccaaactcct
cctcatcctcgtacagatgctacgtggactaatgctcccattaaaacagaaatgtccgaa
aactgggattcccccggtaacgtgttccttcctataaaccacagctccccgaaacgacgg
accggaaagctcgagaagaaactagtttgtaacggatccctaataaaatcgaaacgcaag
gacgtcagtgagcagcacttccagtcggtcaagatggaagcagaaagttctcagtctgag
ccgtcatctgcttccacatccatgtccctgtctccagaggacgcctttccagaaggtaag
gaactgcggtttaaatccctcgctgcggacaacaaggtgacggatccctctgtattccgg
ccgaattccagctacaaattcagtaccttcctcatgcttttgaaagacatccacgatact
agagaaaaagaaggcaatcccctaaaaatccctccacccccagctttaatcaaggaggag
cccctggtgattcccacttcagccgacccactaacaggttcaggtgatggttcaactctc
aggatcatgtcagaaaacgggcagtcagggaaatcctcggtgccccaaagcacacagagg
agagccaagtccaagactcagactgttccagcagctaacacctaccaatgtgaagatgtt
cctctttgcactcagtcagacaagcagcgcaggaaacaaagactaccgtctaaacttaaa
gtcaggaagccttgcccgactgcggacctggcgaacatggctcacggcagggagtttgtc
agtggccacaccgacccgcttgacccaggatctgatcccttcgctgctcctcctgactct
tctgccagctacctcgacgggaactccgaaatctcagcggctccaaagaagcgctggcag
ctggtggaaggtgctgatgagaggatggcgagcgatgcatcgcagcttacaggagcatcg
ccggaggctgtgcctgaaacggagaagcacgcagacagcgactcgctttcgtctgcggga
cagtcggagaacaaacgcctccggaaaccaacaaagagactgctggagtcgacggaggag
tacgaacaaatgttctcctcgaaaaagaggttgaagaaacacggctctgaatcctctaaa
atggagactttggggatgtcgactctccatgacttcagcgcagcggaagggtttgatacc
tcgtcctcggtggatccagccgagtctcagttggagatgaggccgagtctgtctcaggat
gaactgtctcctgtagcaacatcagcctctcctgtttccccccagccatccttcgactct
gaggcagcagagaagactgatctacctctcggatccgatacggcacaaattcaagaaaga
aagaggccgagaaagctttcacataaggtgctcgaatgtacgattgaagaagtgtctgct
gctcctgcgaggaggaaggagcaaaagggccttgctgacatcacttcagacgtgaaggtg
ttggttaagaaaactcagtttgctgctgctgctgctgctgctgctgctgggaagaaggac
ccagttcccagcgcgtccccagactcagctgttgcctccaagcttcctcagagaaggtct
ccaaccccgcaaccatgcaagagccccaagcaagaggatgagacggagccctgcagcact
gaggagaaacaaactacacacactggaacactaactcccaaaccggaggtctgcgtggtt
tttgctgtgctgccaactggtttgaatgacagtttctcttcccaagtggacggaaagggg
aaaacgtcctccttgaaggagaacgtctgtcaggtgtgcgagaggcctggagacttgctg
gtgtgtgaaggccactgttatggagctttccacctgcagtgcgtcggcctgtcggtcgct
cccaaaggaaaattcttctgtcaggaatgcaacacaggggatcatatgtgcttcgtgtgc
aagaagtctggtgacgtgaagcgctgcattatcccgctctgtggcaagttctaccacatg
gactgtattttagcgttttcagccacccagccgcataacaagggcttccgctgccccctg
cacgtgtgcctgtcctgccacatcaccaaccccgtcaacgtcttcagctctaaaggtcga
ctggcccggtgtgtgcgctgcccagtggcctatcacgccaacgacaactgcatggcagca
ggcagcgtggtgctggacaacaacaccttcctctgcccaaaccacttcactccccgcaaa
ggctgcaagaaccacgaacacataaacgtgagctggtgcttcgtctgctctgaagggggc
agcctcctgtgctgcgaagcctgtcctgctgctttccaccgagaatgcctgaacattgag
atgcctcaagggagctggttctgcaacgactgcaaggcgggaaagaagccgcgcattaag
gacatcctctgggtcaaatggggccgttacaggtggtggcccgctgaggtgtgtctggcc
agagacgtcccgaacaacatcctgaggatgaagcatgaggtgggggagttcccggtccag
ttctttggctctaaagatttcgtgtggacataccaggccagggtgttcccctacatggag
ggggacactcacaatatcgagaaaatggggaaaggtgcagacgcaatctataaaaaggct
ctaagcgaggcagcagaacgcttcaaagagctgcagacagagcgagagatgaagcagctc
caggaggacaggaagaacgacaaaaaaccgcctccatatcgacacataaaggtgaacagg
cccattgggaaggtgcagatcatcacagcagacttgtctgaggtccctcgttgcaactgc
aaagcctccgacgagaacccgtgcggcgcggactctgaatgcatcaaccgcatgctgatg
tacgagtgccatccccaggtgtgcgcggcaggggaacggtgccagaaccaggctttcaca
aagcgtcagtacacaactgtagagatctataggacgctgtcctgtgggtggggtttgcgg
gctgtgtccgacatcaagaagggagcatttgtgagtgaatacgtgggggaggttatagat
gaggaagagtgtcgagccaggatcaggcacgctcaggaacacgacatctgtaacttctac
atgctcacactggacaaggaccgggtcattgacgctgggcccaaagggaaccaggcccgc
ttcatgaaccacagctgccagccgaactgcgagacgcagaagtggactgtgaatggagac
acgcgggtggggctgtttgctctgcaggacatcgccaaaggagaggagctgactttcaac
tacaatcttgagtgtcggggcaacggcaagacggtctgcaaatgcggagcgcccaattgt
agcggcttcctgggtgttcgaccaaaaaaccagcccccagcggagaaggtcaaactaaaa
gaagggaagaggagagtgggcatgaagaagaagaccaagcaacaagtgatgaaggagcgg
gaggacgagtgcttcagctgtggcgacgggggtcagatagtgtcatgcaagaagccgggc
tgtccaaaggtttatcatgccgactgcctcaacctcgccaagaggcctgcagggcgatgg
gagtgtccctggcaccagtgtgacctttgtggaaaagaggctgcttcgttctgtgagatg
tgcccaagctcttactgtaaggagcatcgagaaggaatgctcttcatctccaagttggat
ggaaagttgtcctgcagcgaacacgacccatgtggacctgacccacttgagccaggagag
atacgggaatacatgcccagcatggcctctgtgaggcctggcgcggtggctgcaccggtc
ctagatgccagaagagcatcatcctcttcttcctcctcctcctcttcttctccctatgtt
cccatctcttaccctgacagccaaacagcagcatccaagcgagagcctcctcctcgtctc
tacatcaacaccaagacagctacctccagcttcatcccctccagcagctcctacctcgca
gacacgacggaagaaaccacgacctcctcgtccgcctcctccaaggatgagagggaggac
ggggaggtggaggagggggaggtctgtgcgttggacatgcaagaagtggaggaagatgaa
gaggacgaggagaacgacacagagatgttggaagagaaagaggaggaacccatttatggt
ggagatttggtggaagatgaggagggggaggatgaggatgacccctggggtagctgtttt
gatgatgacggagaggtggaagaggaggattttgaatcttggggtaaattggaagatgaa
aagtaa

DBGET integrated database retrieval system