KEGG   Oryzias latipes (Japanese medaka): 101160731Help
Entry
101160731         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04218  Cellular senescence
ola04261  Adrenergic signaling in cardiomyocytes
ola04370  VEGF signaling pathway
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04933  AGE-RAGE signaling pathway in diabetic complications
ola05132  Salmonella infection
Module
ola_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101160731
   04370 VEGF signaling pathway
    101160731
   04068 FoxO signaling pathway
    101160731
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101160731
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101160731
   04621 NOD-like receptor signaling pathway
    101160731
   04622 RIG-I-like receptor signaling pathway
    101160731
   04625 C-type lectin receptor signaling pathway
    101160731
  Endocrine system
   04912 GnRH signaling pathway
    101160731
   04914 Progesterone-mediated oocyte maturation
    101160731
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101160731
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101160731
  Infectious diseases
   05132 Salmonella infection
    101160731
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101160731
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101160731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 101160731
NCBI-ProteinID: XP_004070460
Position
7
AA seq 360 aa AA seqDB search
MSQKERPNFYRQEVNKTIWEVPDRYQNLSPVGSGAYGSVCSAYDTKTGLKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLKEFTDVYFVNHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARLTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLIMMLV
GTPGPELLMKISSESARTYISSLPHMAKRNFADVFIGANPLAVDLLEKMLVLDTDRRITA
AEALEHPYFAQYHDPDDEPEAEPYDQSFESRDLNIKEWKRLTYEELCSFEPPVFNEDDME
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaagaaagacccaatttttaccgacaggaggtcaacaagacaatatgggaa
gtcccggatcggtaccaaaacctgtccccggtgggctctggggcttacggatcggtttgt
tcggcctacgatacaaagacgggtttaaaggttgctgtgaaaaagctttctcgaccattt
cagtccatcatccatgccaagagaacctacagagagctgcgcctgctcaaacacatgaag
catgaaaatgttattgggctcttggatgtcttcacccctgccacttctctaaaggaattc
acggacgtgtattttgttaatcaccttatgggggcagatctcaacaacatcgtgaaatgt
cagaaactcacagacgaccatgtgcagttcctcatatatcagatcctccgaggattaaaa
tacatccactcagcagacatcattcacagagatttaaaacccagtaacttggcagtaaat
gaggactgtgagctgaagattttggactttggtttggcacggctcaccgacgacgagatg
actggctatgtagccacccgctggtaccgagccccagagatcatgttgaactggatgcac
tacaacatgacagtggatatttggtcagtcgggtgtataatggcagaacttctaactgga
cgaactctgtttcctggcacagaccacattgatcagttgaagttaatcatgatgctcgtc
ggaactccagggccagagctcttgatgaaaatatcttcagagtctgccaggacctacatc
agctctttgcctcacatggccaagagaaactttgcggatgtattcatcggtgctaacccg
cttgctgtcgacctcttggagaaaatgttggttctggatacagacagaagaataacagca
gccgaggccctggagcacccctactttgcccagtaccatgatccagatgatgagccggaa
gctgagccttatgaccagagctttgagagccgggatctcaatattaaggagtggaaacga
ttaacctatgaggagctgtgcagctttgagccgcctgtctttaacgaggacgacatggag
tga

DBGET integrated database retrieval system