KEGG   Oryzias latipes (Japanese medaka): 101160773Help
Entry
101160773         CDS       T02443                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101160773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 408 aa AA seqDB search
MAGVNAMEKKLAEYKCDTNEAISLKVVRFPEDVDDDSTTFHPEFSHQVFGDDEIAFGYKG
LQIQLFYTAGNLSTLFKVKYSSKVTEAFDCVEPDDVEGKIREIIPAGFTSNTDDFTSLLE
KEANFKPFGTLLHSYTVHNEEAGEFTYQIHKVEISCPGFREYHERLQTFLMWFIETASFI
DADDDRWDFFLVFEKYNKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGH
GAQLLEAVHRFYCSLPKVQDITAEDPSENYVKLRDFVLVKLCQNLPSFAEDKLLLGFSAD
MVQEAQDKLKINKKHARRVYEILRLRATDMSDEKQAREYRLEVKKRLFGPYRKNQRELAK
MKKCLRPEELVSHMGQMDTQTQHEELEKSYQDVVEGYRRIIERIATHA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcgggagttaacgctatggagaagaaacttgctgaatacaagtgtgataccaacgag
gcaatttccctcaaagttgttcgttttcctgaggatgttgatgatgatagcaccacattt
cacccagagttcagccatcaagtatttggagatgatgagattgcttttggatacaaaggt
cttcagatccagctcttctacacagctggaaacctgagcacgctcttcaaagtgaaatat
tcctcaaaagtcaccgaagcatttgactgcgttgagcccgatgatgtggaggggaagatc
cgggaaataattcccgccgggttcacctcgaacacggatgacttcacctcgctgctggaa
aaggaggccaacttcaagccctttggcacccttcttcactcatacacggtccacaacgag
gaggcgggagagttcacataccagattcacaaggtggagatcagctgccccggattccga
gagtaccacgagcgcctgcagaccttcctcatgtggttcattgagaccgccagcttcatc
gacgccgatgatgatcgctgggacttctttcttgtatttgaaaaatacaataaggacggg
gagactctctacgcaactgttggctacatgacagtttataattactacgtatacccagac
aaaacccgaccacgtgtaagccaaatgctgatcctgcctccattccaaggagaaggccac
ggagctcagcttctggaggcagtgcacaggttttattgcagcctgcctaaagtgcaagat
atcacagctgaagacccttcggagaactatgtgaagctgagagactttgtgttggtgaaa
ctctgccaaaacctgccgtccttcgctgaagacaagctgctcctgggcttctcagcggac
atggtccaagaagcacaagacaagctaaaaattaacaagaaacatgcaaggcgagtgtat
gaaatcttacgcctgcgagcaacagacatgagtgatgaaaaacaagcaagagagtaccga
ttagaggtgaagaagaggctctttggaccgtacaggaagaaccagagggagcttgcaaaa
atgaagaaatgcctgcggccagaagagctggtgtcccacatgggtcagatggacactcag
acgcagcatgaggagctggagaagagctatcaggatgtggtggaaggctacaggagaatc
atcgagaggatagccacacatgcctga

DBGET integrated database retrieval system