KEGG   Oryzias latipes (Japanese medaka): 101160977Help
Entry
101160977         CDS       T02443                                 

Gene name
nup205
Definition
(RefSeq) nucleoporin 205kDa
  KO
K14310  
nuclear pore complex protein Nup205
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101160977 (nup205)
Messenger RNA biogenesis [BR:ola03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     101160977 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1992 aa AA seqDB search
MAGQMAVNLGASLWGPLKELWETVDGAILRRQTESVHLLDLQLKKHKPHFLSLFRNPPKS
TDQKEKVRKASTEGIAIQGQQGSRLLPEQLLTEAFILSDLFDIGEMAALELLLTGEQQQP
QFPGLTRGLVAVLLYWDGKLCVANSLRTLIQSRHGKTFTLDLSGELVALTTRFTDELMNQ
GLTKRILALVSEISVAKEFERLQKERGLGNEKHRKEVGDLIKECRQALADSLFAWTCQSP
LTKDDTLALIGHLETVTAQADGSLDSVNLALVMALLYCLDVSFIEQGTEDREDLLQALPL
LTERQYVSAVHSRLMDNQPWKLPGLQAVCKLAWALTLRVLSQLPQGSALVEFTEADEGLA
DQALLGDVFLFIKEGMLGCDNFTQEEFYIRRLHSLITDFLALMPMKVKQLRNRADEDARL
VHISLQMDSELPSSLRKDLDHLMLLIGEFYSKDQFGLELGLEFWCPTESLQHTTLQGSYL
GMALQRPPHKQVVLSKFVRQMGDLLPSTLYISYLRMLKGLSNGPQCAHYCFSLLKTNGAT
HSDNIQGVSGSPVSWEHFFHSLMLYHENLRRDLPNPDAAQYRHPPLRGITQRELEALTSF
LQLLTTIITWSENARLALCEHPQWTPVVVMLGLLQCSVPPILKAELLHCLAAFGKSPEIA
ASLWPSLEYTQILQTVRVPGQRQAAGIEVELSEIESSSEEYPLTRAFCHLISTLVESSMP
VNLGAGLRVPGFQPYLDFLRESVFLPFTTRAYRRPAEKWEVADAVLEVFHKLLRDYEPQP
SDFIQEMVELQGEQVPTHKLPGHNIMFHLLNESPMLALCLSLLEEGVRQLDTYAPFPGKK
HLESAVLRCLCLLDLTLQKEVVFMDLLRESQASLLVSPLEQLLQGVSSQTRRADHIVNIA
RYLYHSSSNPEAAFQSAKILRRIANYPNIQMRLVGDFTHDQTVSEKLMAGFVECLDNEEA
EEALETEDESDSQKKVSRIRHETQIHILNLLITSLELKSPNLALYLLGYEVKKPVSSTNL
QDPGVLGCPRSCLHAILSLLQRGTEKRSGPVLTQQAPHLAELCYQVIYQLCACPDTSGPT
MRYLRTSQDFLFSHLQHLPFILPGNQIAALSQMSWLMKTAAIELRVTSLNRQRSHTQRLV
SLLLDDQPHAQHASEGESVMEEETRSVSGFLHFDTVSKVRRKLLSVLDAIDFSQDMPELL
QLDFFERAQIEQVISNCEHMNEQGHTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEV
NSILQQVVERNRVRRSLSAKRHALQSWRSLVETLLSACPADLLPADERQLIIRDLLLDLH
DKVLSEDAAGELMPIVAGAVFTLTAHLSQSVLSEQQQVAGLEASSGFASIANSALHLILR
KLLNFILCTGGGYQRLRAHLYGSLLYYLQIAQKPEEPDTLQSGKAMWERLTAPEDGFSKL
QRENLAIIESYGKALMEIVCRDVCDGHEISRMLALAVLDRILSIDRQNQWLVYVCNSGYL
RSLVESLRQDDVALQGLLTPQPPVLKPLYLYESKMALLTRVAKTSQGAVELLRCGLMALL
MECQVFDMVPDSDAHRLMRDPSGFIPSPMDRYRQILLPTLRLLQVILTSVSINHQQGAAQ
VLQWLIVHADTVQSLLRCQELSLGALQELSLLTGIISKTALPGVLEMGGEVNGAALLEFQ
GHITRFQRLCLSLLSRLAGSERERLLKQAEIEAPAESAERREEMEVAMLQVCANIMEYCQ
TLLVQSSAQAQFSICLFSPSGGEPPGRDGGRSDLSSSLPPMVYSRAPSLGLVLYLLKTAA
GDFFQFHQSHRQSLGKLQGLDQLPPEELKELCQGLVSGPGGVEKISSVQRSLLAKRRLVQ
LINNRAKLLALCSYVIETCLFVLWRHLEYYLLHYTPSDPKDSMLTGAGSFRTRLADESFG
ALQAGGGRGLGLSKVSQQDLDQLKGDMAAGFGEALQRKLLEVESSYSQVRSRYTFIQALV
RRIRGLLRQPKS
NT seq 5979 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagatggcggtaaatttaggagccagtctgtgggggccactcaaagagctc
tgggagactgtagatggagctatcctgaggagacagacggagagtgtccacctgttggac
ctgcagctgaaaaagcacaaaccacactttctctcactcttcaggaacccgccaaaaagt
acagaccaaaaagagaaggtacgcaaagccagcacagaaggcatcgccatccagggtcag
caggggtcgcggctccttcccgagcagcttctgacggaggccttcatcctcagcgatctc
tttgacattggggagatggcagccttggagcttctcttgacaggtgaacaacagcagcct
cagtttccaggcctgactcgaggtttagtcgccgtacttctctactgggatggaaagttg
tgtgtggccaactctctgcgcacgctcatccagtcacgccacggcaaaacgttcaccctg
gatttaagcggtgagctggtggctttgaccacacgcttcacagatgagttgatgaaccag
gggctgaccaagcgcatcctcgccctggtgtcggagataagcgtggcgaaggagtttgag
cggctgcagaaggagcgaggtctgggtaatgagaagcacaggaaggaggtcggtgacctc
atcaaagagtgccggcaggctctggcagacagcctgtttgcttggacctgccagtcccct
ttgaccaaagacgacaccctggccctcatcggccacctggagacggttacggctcaggcc
gacgggtcgctggacagcgtgaacctcgctctcgtgatggcgcttctctactgtttggac
gttagttttatagagcaaggaactgaagacagagaagatcttctccaggcgttgccgttg
ctcacggagaggcagtacgtgtcggcagtgcacagccgtctgatggacaaccaaccatgg
aagctccctggactgcaggctgtctgcaagcttgcctgggccctgactctgagggtcctg
tctcaactaccacagggctcagctttagtggaattcacagaagcagatgaaggcctggct
gaccaggctctgctgggagatgtcttcctgttcataaaggagggcatgctgggatgtgac
aacttcactcaggaagagttttacatccgccgccttcattcgctcatcacagacttcctg
gctttgatgcctatgaaggtgaagcagctgcggaaccgcgctgacgaggacgctcgtctg
gtgcacatctctctgcagatggacagtgagcttccgtcatctttgaggaaggacttggac
cacctcatgcttctgattggggaattttacagcaaagatcagtttgggctggagctggga
ctggagttttggtgtccgacggagtcgcttcagcacaccacgctgcagggatcctacctg
ggaatggctctgcaaaggccccctcataaacaggtggttttgtccaaatttgtgcgtcag
atgggagatcttctgccctccaccctctacatttcttacctgcgaatgctgaaaggcctc
tccaacggtccacagtgcgctcactactgcttcagtctgcttaaaacaaacggagccaca
cacagtgacaacatccagggagtttcgggaagcccggtctcatgggaacacttttttcac
tccctcatgctctaccacgagaacctgcggcgagacctgcctaacccggacgcggcgcag
taccgccacccgccgctcagaggcatcacccagcgagagctggaggcgctgacctccttc
ctgcagctgctcaccaccatcatcacatggagcgaaaatgctcggctggcgctgtgcgag
cacccgcagtggacccccgtggtggtgatgttgggtctgctgcagtgcagcgttccaccc
atcctgaaggcggagctcctgcactgcctggcggccttcgggaagtccccagagattgct
gcgtcgctctggccgtcgctggagtacacgcagattctgcagacggttcgagtcccagga
cagcggcaagctgcaggaatagaggtggagctgagtgagatcgagtcgagctcagaggaa
tacccgctgacgcgagccttctgtcacctgatcagcaccttggtggagagcagcatgccc
gttaatctgggcgccgggctgcgggtgccgggctttcagccctacctggacttcctacgc
gagtctgtgttcctgccctttaccaccagggcgtaccggcgtccggctgagaagtgggag
gtggcggacgccgtcctggaggttttccataagctgctgcgggactacgagccgcagccc
tcggacttcatccaagagatggtggagcttcagggcgagcaggttccgacgcacaagctc
ccgggccacaacatcatgttccacctgctcaacgagtcccccatgttggcgctctgtctg
agcctgctggaggaaggcgtacgccagctggacacttacgcccccttccccggtaaaaag
cacttggagtcggcagtgttgcgctgcctgtgtcttctggacttgactctgcagaaggag
gtggtgttcatggacctcctcagggagagccaggcctccctgctggtttctcctctggag
cagctccttcagggcgtcagctctcagacccgacgagccgatcacattgtcaacattgcc
aggtatctttaccacagcagctcaaacccagaagcggctttccagagcgccaaaattctg
cgtcgcatcgcgaactaccccaacatccagatgagactggtgggagatttcacacacgac
cagacagtgagtgagaagctcatggctggttttgtggagtgtctggacaatgaagaagca
gaagaagcgttagaaacagaagacgaatcggattcccaaaagaaggtgtcgagaatccgc
cacgaaacccagatccacatcctgaacctgctcatcacctctttggagctaaagtcgccc
aacctggctctttatcttctgggctatgaagtcaagaagcccgtgtcctccaccaacctc
caggacccgggtgtgctgggatgtccgcgaagctgcctgcacgccatcctgagcctgctg
cagagaggaacggagaagaggtccgggcccgtcctcacacagcaggccccacacctggct
gagctttgctaccaggtgatctaccagctgtgtgcctgtccagacacatccggacccacc
atgcgctatttgaggaccagccaggacttcctgttttctcatttgcagcacctgcccttc
atcctgccagggaatcagatagccgccctctcccagatgtcctggctcatgaaaaccgct
gccattgagctgagagtgacctcgctgaaccgccagcgctcgcacacgcagcgcctcgtc
agcctgctgcttgatgaccagccgcacgctcagcatgcatctgaaggagaatcagtcatg
gaagaagaaaccagatccgtcagcggtttccttcatttcgacacagtttctaaggtgcgc
agaaagttgctgagcgtactggatgccatcgacttcagtcaggacatgccggagctgctg
cagctggatttctttgagcgcgctcagatcgagcaggtgatctccaactgcgagcacatg
aatgaacagggacacaccgtttgcaacgtgaagctgctccatagagtgctggtcgctgag
gtgaacgctctgcagggaatggccgcgattggacagaggcccttgttaatggaagaggtg
aactccatcctgcagcaggtggtggagcggaaccgcgtgcggcggagtctgagcgccaag
cgccacgctctgcagtcctggagaagtttggtggaaacgctgctgagcgcctgcccagct
gatctccttcctgcagacgagagacagctcatcatcagagacctgctgctggatctgcat
gataaggtgttgtcagaggatgcagcgggagagttgatgcccatcgtggcgggcgctgtc
ttcactctgaccgcccacctcagccagtctgtgctgtcggagcagcagcaggtggcggga
ctcgaagcgtcttcgggctttgcttccatcgccaactcagccctgcacctgatcctccgc
aagctgctgaatttcatcctctgcaccggaggcggataccagcgcctgcgagctcacctg
tacggctctttgctgtactacctgcaaatcgctcagaaacccgaggagccagacacgttg
cagtcaggaaaagccatgtgggagcgtctgacggctcccgaggacggattctccaaactg
cagagggagaacctcgccatcatcgaaagctacggcaaagctctcatggagatcgtgtgt
agggacgtgtgtgacggccatgaaatcagcaggatgctggctctggcagtgctggaccgg
atcctgtccatagaccgtcagaaccagtggctggtgtacgtgtgcaacagcggttacctg
cgctcattggtggagagtctgaggcaggatgatgtcgccctgcagggccttctcacccct
cagccccccgtcctgaaacctctgtacctgtacgagagcaagatggctctgctgacccgc
gtggcgaagacctcccagggcgccgtggagctgctgcgctgtggcctgatggctctgctg
atggagtgtcaggtgtttgacatggtccctgacagcgacgcacacagactgatgagagac
ccatcgggcttcatcccttcccctatggaccgctaccgccagattctactaccaaccctc
agactccttcaggtcattctgacctctgtgtccatcaaccaccagcagggggcagcacag
gttctccagtggctcatcgtccacgcagacactgttcagtctctgctgcgctgccaggag
ctcagtctgggagctttgcaggagctgtccttgctcaccggcatcatcagtaaaaccgcg
ctgcctggcgtactcgagatgggcggagaggtcaacggcgccgctctcctggagttccaa
ggtcacattaccagatttcagcgtctgtgtctgtctctgctcagccgactggctggaagt
gagagggagaggctgttgaagcaggcggagatcgaagcgcccgctgagtcagcagaacgc
agggaggagatggaggtggccatgctgcaggtgtgcgccaacataatggagtactgccag
accctcctggtgcagagctcggcccaggctcagttcagcatctgcctcttcagcccctca
ggcggcgagccgcctggcagggacggagggcgctccgatctgtcctcctctctgccgccg
atggtgtactcccgagcccccagcctggggctggtcctgtacctgctgaagaccgcggct
ggagacttcttccagttccaccaaagtcacaggcagagtctggggaagctgcagggcctg
gaccagctgccccccgaggagctcaaggagctgtgtcagggcttggtgtcgggccctgga
ggggtagagaagatctcatcagtccaaaggagcttgctggccaagagacgactggtgcag
ctgatcaacaaccgagccaagctgctggccttgtgctcatatgtcattgaaacctgcttg
tttgtgctgtggcgacacctagagtattatttgttgcactacaccccgtctgatccgaaa
gactccatgctgaccggagcgggatcattcagaacccgcctcgcagacgaatcctttggt
gcattgcaggctggcggcggccgtgggctgggcttgtccaaagtcagccagcaggacttg
gatcagctgaaaggcgacatggcggcgggcttcggcgaagctctgcagaggaagctgctg
gaggtggagagctcgtacagccaggtccgctcccgctacaccttcatccaggctctggtt
cgcaggattcgaggtttgctgcgacagcccaaaagttga

DBGET integrated database retrieval system