KEGG   Oryzias latipes (Japanese medaka): 101160977Help
Entry
101160977         CDS       T02443                                 

Definition
nuclear pore complex protein Nup205-like
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101160977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1993 aa AA seqDB search
MAGQMAVNLGASLWGPLKELWETVDGAILRRQTESVHLLDLQLKKHKPHFLSLFRNPPKS
TDQKEKVRKASTEGIAIQGQQGSRLLPEQLLTEAFILSDLFDIGEMAALELLLTGEQQQP
QFPGLTRGLVAVLLYWDGKLCVANSLRTLIQSRHGKTFTLDLSGELVALTTRFTDELMNQ
GLTKRILALVSEISVAKEFERLQKERGLGNEKHRKEVGDLIKECRQALADSLFAWTCQSP
LTKDDTLALIGHLETVTAQADGSLDSVNLALVMALLYCLDVSFIEQGTEDREDLLQALPL
LTERQYVSAVHSRLMDNQPWKLPGLQAVCKLAWALTLRVLSQLPQGSALVEFTEADEGLA
DQALLGDVFLFIKEGMLGCDNFTQEEFYIRRLHSLITDFLALMPMKVKQLRNRADEDARL
VHISLQMDSELPSSLRKDLDHLMLLIGEFYSKDQFGLELGLEFWCPTESLQHTTLQGSYL
GMALQRPPHKQVVLSKFVRQMGDLLPSTLYISYLRMLKGLSNGPQCAHYCFSLLKTNGAT
HSDNIQGVSGSPVSWEHFFHSLMLYHENLRRDLPNPDAAQYRHPPLRGITQRELEALTSF
LQLLTTIITWSENARLALCEHPQWTPVVVMLGLLQCSVPPILKAELLHCLAAFGKSPEIA
ASLWPSLEYTQILQTVRVPGQRQAAGIEVELSEIESSSEEYPLTRAFCHLISTLVESSMP
VNLGAGLRVPGFQPYLDFLRESVFLPFTTRAYRRPAEKWEVADAVLEVFHKLLRDYEPQP
SDFIQEMVELQGEQVPTHKLPGHNIMFHLLNESPMLALCLSLLEEGVRQLDTYAPFPGKK
HLESAVLRCLCLLDLTLQKEVVFMDLLRESQASLLVSPLEQLLQGVSSQTRRADHIVNIA
RYLYHSSSNPEAAFQSAKILRRIANYPNIQMRLVGDFTHDQTVSEKLMAGFVECLDNEEA
EEALETEDESDSQKKVSRIRHETQIHILNLLITSLELKSPNLALYLLGYEVKKPVSSTNL
QDPGVLGCPRSCLHAILSLLQRGTEKRSGPVLTQQAPHLAELCYQVIYQLCACPDTSGPT
MRYLRTSQDFLFSHLQHLPFILPGNQIAALSQMSWLMKTAAIELRVTSLNRQRSHTQRLV
SLLLDDQPHAQHASEGESVMEEETRSVSGFLHFDTVSKVRRKLLSVLDAIDFSQDMPELL
QLDFFERAQIEQVISNCEHMNEQGHTVCNVKLLHRVLVAEVNALQGMAAIGQRPLLMEEV
NSILQQVVERNRVRRSLSAKRHALQSWRSLVETLLSACPADLLPADERQLIIRDLLLDLH
DKVLSEDAAGELMPIVAGAVFTLTAHLSQSVLSEQQQVAGLEASSGFASIANSALHLILR
KLLNFILCTGGGYQRLRAHLYGSLLYYLQIAQKPEEPDTLQSAGKAMWERLTAPEDGFSK
LQRENLAIIESYGKALMEIVCRDVCDGHEISRMLALAVLDRILSIDRQNQWLVYVCNSGY
LRSLVESLRQDDVALQGLLTPQPPVLKPLYLYESKMALLTRVAKTSQGAVELLRCGLMAL
LMECQVFDMVPDSDAHRLMRDPSGFIPSPMDRYRQILLPTLRLLQVILTSVSINHQQGAA
QVLQWLIVHADTVQSLLRCQELSLGALQELSLLTGIISKTALPGVLEMGGEVNGAALLEF
QGHITRFQRLCLSLLSRLAGSERERLLKQAEIEAPAESAERREEMEVAMLQVCANIMEYC
QTLLVQSSAQAQFSICLFSPSGGEPPGRDGGRSDLSSSLPPMVYSRAPSLGLVLYLLKTA
AGDFFQFHQSHRQSLGKLQGLDQLPPEELKELCQGLVSGPGGVEKISSVQRSLLAKRRLV
QLINNRAKLLALCSYVIETCLFVLWRHLEYYLLHYTPSDPKDSMLTGAGSFRTRLADESF
GALQAGGGRGLGLSKVSQQDLDQLKGDMAAGFGEALQRKLLEVESSYSQVRSRYTFIQAL
VRRIRGLLRQPKS
NT seq 5982 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagatggcggtaaatttaggagccagtctgtgggggccactcaaagagctc
tgggagactgtagatggagctatcctgaggagacagacggagagtgtccacctgttggac
ctgcagctgaaaaagcacaaaccacactttctctcactcttcaggaacccgccaaaaagt
acagaccaaaaagagaaggtacgcaaagccagcacagaaggcatcgccatccagggtcag
caggggtcgcggctccttcccgagcagcttctgacggaggccttcatcctcagcgatctc
tttgacattggggagatggcagccttggagcttctcttgacaggtgaacaacagcagcct
cagtttccaggcctgactcgaggtttagtcgccgtacttctctactgggatggaaagttg
tgtgtggccaactctctgcgcacgctcatccagtcacgccacggcaaaacgttcaccctg
gatttaagcggtgagctggtggctttgaccacacgcttcacagatgagttgatgaaccag
gggctgaccaagcgcatcctcgccctggtgtcggagataagcgtggcgaaggagtttgag
cggctgcagaaggagcgaggtctgggtaatgagaagcacaggaaggaggtcggtgacctc
atcaaagagtgccggcaggctctggcagacagcctgtttgcttggacctgccagtcccct
ttgaccaaagacgacaccctggccctcatcggccacctggagacggttacggctcaggcc
gacgggtcgctggacagcgtgaacctcgctctcgtgatggcgcttctctactgtttggac
gttagttttatagagcaaggaactgaagacagagaagatcttctccaggcgttgccgttg
ctcacggagaggcagtacgtgtcggcagtgcacagccgtctgatggacaaccaaccatgg
aagctccctggactgcaggctgtctgcaagcttgcctgggccctgactctgagggtcctg
tctcaactaccacagggctcagctttagtggaattcacagaagcagatgaaggcctggct
gaccaggctctgctgggagatgtcttcctgttcataaaggagggcatgctgggatgtgac
aacttcactcaggaagagttttacatccgccgccttcattcgctcatcacagacttcctg
gctttgatgcctatgaaggtgaagcagctgcggaaccgcgctgacgaggacgctcgtctg
gtgcacatctctctgcagatggacagtgagcttccgtcatctttgaggaaggacttggac
cacctcatgcttctgattggggaattttacagcaaagatcagtttgggctggagctggga
ctggagttttggtgtccgacggagtcgcttcagcacaccacgctgcagggatcctacctg
ggaatggctctgcaaaggccccctcataaacaggtggttttgtccaaatttgtgcgtcag
atgggagatcttctgccctccaccctctacatttcttacctgcgaatgctgaaaggcctc
tccaacggtccacagtgcgctcactactgcttcagtctgcttaaaacaaacggagccaca
cacagtgacaacatccagggagtttcgggaagcccggtctcatgggaacacttttttcac
tccctcatgctctaccacgagaacctgcggcgagacctgcctaacccggacgcggcgcag
taccgccacccgccgctcagaggcatcacccagcgagagctggaggcgctgacctccttc
ctgcagctgctcaccaccatcatcacatggagcgaaaatgctcggctggcgctgtgcgag
cacccgcagtggacccccgtggtggtgatgttgggtctgctgcagtgcagcgttccaccc
atcctgaaggcggagctcctgcactgcctggcggccttcgggaagtccccagagattgct
gcgtcgctctggccgtcgctggagtacacgcagattctgcagacggttcgagtcccagga
cagcggcaagctgcaggaatagaggtggagctgagtgagatcgagtcgagctcagaggaa
tacccgctgacgcgagccttctgtcacctgatcagcaccttggtggagagcagcatgccc
gttaatctgggcgccgggctgcgggtgccgggctttcagccctacctggacttcctacgc
gagtctgtgttcctgccctttaccaccagggcgtaccggcgtccggctgagaagtgggag
gtggcggacgccgtcctggaggttttccataagctgctgcgggactacgagccgcagccc
tcggacttcatccaagagatggtggagcttcagggcgagcaggttccgacgcacaagctc
ccgggccacaacatcatgttccacctgctcaacgagtcccccatgttggcgctctgtctg
agcctgctggaggaaggcgtacgccagctggacacttacgcccccttccccggtaaaaag
cacttggagtcggcagtgttgcgctgcctgtgtcttctggacttgactctgcagaaggag
gtggtgttcatggacctcctcagggagagccaggcctccctgctggtttctcctctggag
cagctccttcagggcgtcagctctcagacccgacgagccgatcacattgtcaacattgcc
aggtatctttaccacagcagctcaaacccagaagcggctttccagagcgccaaaattctg
cgtcgcatcgcgaactaccccaacatccagatgagactggtgggagatttcacacacgac
cagacagtgagtgagaagctcatggctggttttgtggagtgtctggacaatgaagaagca
gaagaagcgttagaaacagaagacgaatcggattcccaaaagaaggtgtcgagaatccgc
cacgaaacccagatccacatcctgaacctgctcatcacctctttggagctaaagtcgccc
aacctggctctttatcttctgggctatgaagtcaagaagcccgtgtcctccaccaacctc
caggacccgggtgtgctgggatgtccgcgaagctgcctgcacgccatcctgagcctgctg
cagagaggaacggagaagaggtccgggcccgtcctcacacagcaggccccacacctggct
gagctttgctaccaggtgatctaccagctgtgtgcctgtccagacacatccggacccacc
atgcgctatttgaggaccagccaggacttcctgttttctcatttgcagcacctgcccttc
atcctgccagggaatcagatagccgccctctcccagatgtcctggctcatgaaaaccgct
gccattgagctgagagtgacctcgctgaaccgccagcgctcgcacacgcagcgcctcgtc
agcctgctgcttgatgaccagccgcacgctcagcatgcatctgaaggagaatcagtcatg
gaagaagaaaccagatccgtcagcggtttccttcatttcgacacagtttctaaggtgcgc
agaaagttgctgagcgtactggatgccatcgacttcagtcaggacatgccggagctgctg
cagctggatttctttgagcgcgctcagatcgagcaggtgatctccaactgcgagcacatg
aatgaacagggacacaccgtttgcaacgtgaagctgctccatagagtgctggtcgctgag
gtgaacgctctgcagggaatggccgcgattggacagaggcccttgttaatggaagaggtg
aactccatcctgcagcaggtggtggagcggaaccgcgtgcggcggagtctgagcgccaag
cgccacgctctgcagtcctggagaagtttggtggaaacgctgctgagcgcctgcccagct
gatctccttcctgcagacgagagacagctcatcatcagagacctgctgctggatctgcat
gataaggtgttgtcagaggatgcagcgggagagttgatgcccatcgtggcgggcgctgtc
ttcactctgaccgcccacctcagccagtctgtgctgtcggagcagcagcaggtggcggga
ctcgaagcgtcttcgggctttgcttccatcgccaactcagccctgcacctgatcctccgc
aagctgctgaatttcatcctctgcaccggaggcggataccagcgcctgcgagctcacctg
tacggctctttgctgtactacctgcaaatcgctcagaaacccgaggagccagacacgttg
cagtcagcaggaaaagccatgtgggagcgtctgacggctcccgaggacggattctccaaa
ctgcagagggagaacctcgccatcatcgaaagctacggcaaagctctcatggagatcgtg
tgtagggacgtgtgtgacggccatgaaatcagcaggatgctggctctggcagtgctggac
cggatcctgtccatagaccgtcagaaccagtggctggtgtacgtgtgcaacagcggttac
ctgcgctcattggtggagagtctgaggcaggatgatgtcgccctgcagggccttctcacc
cctcagccccccgtcctgaaacctctgtacctgtacgagagcaagatggctctgctgacc
cgcgtggcgaagacctcccagggcgccgtggagctgctgcgctgtggcctgatggctctg
ctgatggagtgtcaggtgtttgacatggtccctgacagcgacgcacacagactgatgaga
gacccatcgggcttcatcccttcccctatggaccgctaccgccagattctactaccaacc
ctcagactccttcaggtcattctgacctctgtgtccatcaaccaccagcagggggcagca
caggttctccagtggctcatcgtccacgcagacactgttcagtctctgctgcgctgccag
gagctcagtctgggagctttgcaggagctgtccttgctcaccggcatcatcagtaaaacc
gcgctgcctggcgtactcgagatgggcggagaggtcaacggcgccgctctcctggagttc
caaggtcacattaccagatttcagcgtctgtgtctgtctctgctcagccgactggctgga
agtgagagggagaggctgttgaagcaggcggagatcgaagcgcccgctgagtcagcagaa
cgcagggaggagatggaggtggccatgctgcaggtgtgcgccaacataatggagtactgc
cagaccctcctggtgcagagctcggcccaggctcagttcagcatctgcctcttcagcccc
tcaggcggcgagccgcctggcagggacggagggcgctccgatctgtcctcctctctgccg
ccgatggtgtactcccgagcccccagcctggggctggtcctgtacctgctgaagaccgcg
gctggagacttcttccagttccaccaaagtcacaggcagagtctggggaagctgcagggc
ctggaccagctgccccccgaggagctcaaggagctgtgtcagggcttggtgtcgggccct
ggaggggtagagaagatctcatcagtccaaaggagcttgctggccaagagacgactggtg
cagctgatcaacaaccgagccaagctgctggccttgtgctcatatgtcattgaaacctgc
ttgtttgtgctgtggcgacacctagagtattatttgttgcactacaccccgtctgatccg
aaagactccatgctgaccggagcgggatcattcagaacccgcctcgcagacgaatccttt
ggtgcattgcaggctggcggcggccgtgggctgggcttgtccaaagtcagccagcaggac
ttggatcagctgaaaggcgacatggcggcgggcttcggcgaagctctgcagaggaagctg
ctggaggtggagagctcgtacagccaggtccgctcccgctacaccttcatccaggctctg
gttcgcaggattcgaggtttgctgcgacagcccaaaagttga

DBGET integrated database retrieval system