KEGG   Oryzias latipes (Japanese medaka): 101161031Help
Entry
101161031         CDS       T02443                                 

Definition
(RefSeq) choline kinase alpha isoform X1
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00564  Glycerophospholipid metabolism
ola01100  Metabolic pathways
Module
ola_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
ola_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101161031
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101161031
    2.7.1.82  ethanolamine kinase
     101161031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Kdo Helo_like_N
Motif
Other DBs
NCBI-GeneID: 101161031
NCBI-ProteinID: XP_023811255
Position
6
AA seq 419 aa AA seqDB search
MKTKFINGVSSSPSMSLGLLVTEHALQVQPDIPEDCKELARPSDQADQDTRRKAFLWCRE
FLHGAWKELTEEDFQITVIRGGLSNKLFLCSLPDSLDSVGDEPRSVLLRLYGAILQMSCN
KGDSGQSNKENHFQGAEAMVLESVMFAILAERELGPKLYGIFPQGRLEQYVPSRKLDTWE
LSEPSISAEVAEKMARFHAMRMPFNKEPKWLFGTMEKYLSQVMRLNFTRETHLRRFNRLL
ALNLPQEMEMLKSLLESTNSPVVFCHNDCQEGNILLLKGRQSSDKQKLMLIDFEYSSYNY
RGFDIGNHFCEWMYDYSCEEHPFFRADAQKYPSKTQQLHFIESYLRESDGGFDNLSSADQ
MKLKEELFVEVNRFAMASHFFWGLWSLIQARLSTIEFGYLEYAKARFEAYFQQKKIWAA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaattcatcaacggggtttcctcctccccgtctatgtctctgggtctgctg
gtgaccgaacacgccctgcaggtccagcccgacatcccggaggactgcaaggagctggcc
cgccccagcgaccaggcggaccaggacacccgccgaaaggccttcctgtggtgccgggag
ttcctgcacggagcctggaaggagctgaccgaggaggacttccagatcaccgtcatcagg
ggtggtctgagcaacaagctcttcctgtgcagcctccctgacagcctggactctgtcggg
gacgagccgcggagcgtcctgctgcgcctctatggggccatcctgcagatgtcctgtaat
aaaggagattctgggcagtcaaacaaagaaaatcacttccaaggtgcagaggccatggtg
ctggagagcgtcatgtttgccatcttggctgagagggagcttggacccaaactctatggc
attttccctcaaggacgcctggagcagtatgttcctagccgtaaactggacacctgggag
ctgagtgaacccagcatctctgctgaggtcgcagagaagatggcccgcttccatgccatg
aggatgcccttcaacaaggagccaaagtggctctttggaaccatggagaagtacctgagc
caagttatgaggctgaacttcaccagagagacccacctgcgccgctttaaccgcctgctg
gccctcaacctaccacaggagatggaaatgctcaagtcactactggagtccaccaactct
cctgtggtgttctgtcacaacgactgtcaagaaggtaacatcctgctgttgaagggccga
cagagttctgacaaacagaagctgatgctcatcgactttgaatacagcagctacaactac
aggggcttcgacatcggcaaccatttctgtgagtggatgtatgactacagctgtgaggag
caccccttcttcagagctgatgctcagaagtacccctcaaagacccagcagcttcacttc
attgaaagctacctgcgggagtctgacggcggcttcgacaacctgagctccgccgaccaa
atgaagctgaaggaggagttgtttgtggaggtgaacaggtttgccatggcgtcccacttc
ttctggggcttgtggtccctcatccaggcccgtctgtccaccatcgagtttggatacctg
gagtacgccaaagccaggtttgaggcttacttccagcagaaaaagatctgggcggcctaa

DBGET integrated database retrieval system