KEGG   Oryzias latipes (Japanese medaka): 101161079Help
Entry
101161079         CDS       T02443                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific-like
  KO
K15588  
histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
  Amino acid metabolism
   00310 Lysine degradation
    101161079
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101161079
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101161079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
14
AA seq 2507 aa AA seqDB search
MSGPTSGPGRKSLHSTCPLTPTRDPSTHSGPSRRHSHKVDLTMSAAASSLKHTSVYGFAQ
MDSSSTLPSSSYSPLRRLQHLTTMVSQSDLVLPLKEPESAWKWGAQKSDRMEGDKNSWSD
CRKFSGSQTMSREETPAQSAYGQKQAEVQKGRSESDSVRFTDSATDEKRTEGCFSGPPSP
AFSLDSNSPFANGLLHFESSLFEDEENDEEQGTTSPIGGLRDKEQGTENASESSPRKLSS
NSKEAALPSAKVVTRSQSSGLRRRYWDGSEDEWYSDSELFLFDDSSSKQSVQPNSLKKNS
LPPLKFVEDEVVWAKFNRRPWWPCEVLVDPAQGVYHKVKEPSDRPCRLYHVRTFGQPEEQ
VWVEDKSIHTFHGGFEFERLLLLRRRGKQRVQNNKCTIAKRFQESWKFSVAEAEAVLPAR
PKMASISFSMDDLCQFSSPPETEKKSQPTLTPFTLPACTLSETSHLTNGSLSSPITPAEK
PSTLGKSSSKKKSKSSKDPNSKHVKKTLHNSPKDTDRNNEECPYSDLESVPKILCPKALE
RQTNSVPSQPSVMVAKELKKQPEVQSGLWFSKSGKDRRPKTTSPMPDRSLFSKLPSKKKN
SSTVCKKTLITTPSYVSGSGDSAPLLDKNKPAETSLVPRKTSSLNCTNNQAGIKTSDSVE
AFVDQPDLLDREKNLLSVEVVCLKARPSASKSTDSVSEPPSSKRESKDDKRDSELSKNVD
FDGQSSLFKNKKNVSETKNSVKIATKPVNDTIFDQEKKTDKTIKLCLQSKSNDSLSILEK
QTSLVSKCRLPYVKLIRKEIKDRRYLNSSGTVFTAGTVVCKEKEKEPNGTKTCQSQQKDS
RTSASKDHSVAEPEKGSVKKVKTIDRSGKLHLSTDQSLGNRTEVSSVSAVDLGSKLVEEA
VLNSKTRKETQSTSKQTHLPESKNNPGSAVPNKSSEQEKGSEEHISSISASTANALPGLC
EEEPLCEDYRTPESFCSGKPKKVSKKSKRVREVNEVLKAQPAHLPASNRLMTRALRAMCD
PTKQDIVGKKAEQKQILKSFRKTNHVRKNHKTKLEFYTKIKALKSHHPDKSECDQGKISS
SSSPSLMFSDSSDFEDVKSEDEDLSISSTPPMDFIPLTSKVKTKHEGQSSDIYSPSPPSP
FSFLRAFKNVEEVSFQSLGADRGGKPISFKPKPNCRFSTFLMMLKDLHDTRERDGAPLEL
EIGPPSAHVKKEPLVMPGEAASAGGDQETTCALTDSSAIPDKSVEALNEGGASQTPKKSS
NRRTNSGWFKSKPNRRAPCSPAKSGPGFPGLESLSEMMPAEDSLEAMEWSSRVVDFQSSS
WDEPGGGSDAVGAEQQEENPWSMAKQNLTAPLLLEQRERDTAEEQPDCLVSDFIKRDSSF
ANISGEDDKAVGAHKRVRKPSKRLIEWTEEYEQIFGTRKKTKKPLQLIGKASPTPVTSAP
EPLDSDNNTSDRPPSTALPEIQTPPPEEIAATTPPELQIPSSQHTKPRDTPVLSTDTLTP
PPEVEPLLSEVSPKDNKEVSLPVLEKKRKRKPTQKILEYCLEAEASTGPKKKIKGLRNNS
SSTAHSDSAPPLLKLKSKAALTPTPTSEVTPCPPTPSIQINHRAALPPHPAPSPPEPRQL
ETAKADAPPAEDQNIPDDPKDVSEGEGDQCSPDHSFSSAKDDFGLCDDSVLPARKIIGDR
GGPASMKETICQVCEKTGELLLCEGQCCGAFHLACISLADAPKGKFVCPECKSGVHTCFV
CKKRGEDVRRCMIPVCGKFYHGECITNHAPTAPVNRGFRCSIHVCLTCFIANPNSSSISK
GRLVRCVRCPVAYHATDLCMAAGSVVLSSNSIVCPNHFTPRRGVKNHEHVNVSWCFVCTE
GGSLLCCESCPAAFHRECLNIEMPKGSWYCNDCKAGKKPHYKDILWVKVGRYRWWPAEVS
HPKTIPENIQRMRHDVGEFPVHFFGSNDYLWTYQARVFPYMDVDANSKEKMGKGVDTTYK
KALEEAAVRFRELQAEKELRQLQEDRKNDRKPPPYKHIKVNRPIGKVQIFTADLSEVPRC
NCKATDESPCGSDSECINRMLLYECNPQVCPAGEKCLNQAFTKRQYSQVEIFRTLSRGWG
LRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYMLTLDKDRIIDAGPKGNE
ARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFNYNLECLGNGKTVCKCGAP
NCSGFLGVRPKNNPPSDDKGRKMKRRGHGRRKKKVVLAKEREDECFSCGDGGQMVSCKKP
GCPKVYHADCLNLTKRPAGRWECPWHQCDVCGKEAASFCEMCPSSYCCQHRDGLLFISKL
DGKLSCSEHDPCGPEPLEPGEIREYNPAPRALTSGLGMAVIPAAAASSSARSLRQTDRGA
HEGGDGGGAGEPFPPFSIKVPITIPVAPPAASPPHTDTPSSPFHLPHYSPISSYEEERDV
FEEDEEELLEDSHDDGEAVMEEEEEEEEGLDYLELEEEQEEDEDEEE
NT seq 7524 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggcctacctcaggccctggaagaaagagtcttcattccacctgccctctgacc
cccacccgtgacccgtccacccactcaggcccctccaggcggcacagccacaaggtcgac
ctaacgatgtctgcagcagcttcctccctcaagcacacgtccgtctatggatttgcacag
atggactcctcctcaacgttaccgtcttcttcctacagccctctgaggaggctgcagcat
ctcaccaccatggtgagccagtcggacttggtcctgcctctgaaggagccggagagtgcc
tggaagtggggggctcagaagagtgataggatggagggggacaagaactcctggtctgat
tgcagaaagttttctggctcccagacgatgagcagagaggagacacctgctcagtctgct
tatggacaaaagcaagcggaggttcaaaagggaagatctgaatcagactctgtacgtttt
acagattctgcgacggacgagaagaggactgaaggttgtttctcgggcccaccgagtcca
gccttctctctggacagtaacagcccctttgcaaatggtttgctccactttgagtcttct
ttatttgaggatgaagagaacgatgaagagcaagggactacatctcccattggaggtttg
agggacaaagagcaggggacggagaatgcctctgagtcctctccaaggaaactgagttca
aactccaaggaagcggctctcccctcagcgaaagtggtcacccgctcccagtcgtctggt
ctacgcagaagatactgggacggctcagaagatgagtggtacagcgactctgagctgttc
ctgttcgatgacagctcctcaaagcaatcagtgcagccaaacagcctgaagaaaaactct
ttgccgcctctgaagtttgtcgaggacgaagtggtttgggcaaagttcaaccgaagacca
tggtggccgtgtgaggtgcttgttgaccccgcacagggagtctaccacaaagtgaaagaa
cccagtgaccggccttgtcggctttaccacgtcaggaccttcgggcagccagaagagcag
gtctgggtcgaggacaaatcaatccacacgttccatggaggatttgaatttgaaagactt
cttcttctgcgccggagagggaaacaaagggtgcagaacaacaagtgcactatcgcaaag
cgtttccaggaatcgtggaagttcagcgtggcagaggctgaagctgttttgcctgctcga
ccaaaaatggcctcgatatctttttccatggatgacctgtgccagttcagctccccaccg
gagaccgaaaagaaaagtcagccaactttgactcctttcactttacctgcctgcactctt
tctgaaacatcgcacttaactaatggatccctttcctccccgattacacctgctgaaaag
ccaagtactttaggtaaatcctccagcaagaagaaaagcaaatcctcaaaggaccccaac
agtaaacatgttaaaaagacactgcacaatagccctaaagacacagacagaaacaatgaa
gaatgtccatactcagaccttgagtcagtccctaaaattttgtgtcctaaagcacttgaa
cgtcaaacgaactcagttccctcccagccgtctgtcatggtggccaaagagctgaagaaa
cagccggaggttcaaagtggtctttggttcagcaaatcaggcaaagacagacgacctaag
actaccagtcccatgccggaccgctctctcttcagtaagctgccctctaagaaaaagaac
tcatctactgtttgtaaaaagaccctcattactaccccttcctatgttagtgggtctgga
gactctgcaccacttttagataagaataaaccagcagaaaccagtctggtaccccgaaaa
actagctccttgaattgtacgaataatcaggctggtattaaaacgtctgattcagttgaa
gcttttgtggatcagcctgacttgttggacagagagaagaacctgctttcagttgaagta
gtgtgtttaaaggctagaccgtcagccagtaagtcaactgattctgtttcagagccgcca
tccagcaagagggaaagcaaagatgataaaagagattcagagctctcaaagaatgtcgat
tttgatggtcaatcgagcctatttaagaataaaaagaatgtcagtgaaacgaaaaattca
gtcaagattgctactaaaccagtgaatgacactatttttgaccaagaaaagaaaactgac
aagactatcaagttgtgtttacaatctaaatccaatgactcattatcaatcctggagaag
caaacaagtttagtctcaaagtgcaggttgccctatgtaaaattgatccgcaaggagata
aaggataggaggtatttaaactcaagcgggactgtttttaccgctggcacggttgtgtgc
aaagagaaagaaaaggaacccaatgggacgaaaacttgtcaatcccaacagaaagacagt
agaacaagtgcctccaaagatcacagcgtggctgagcctgaaaagggctctgtaaagaaa
gtcaaaaccattgataggtctggtaagcttcatctctccacagaccagtcacttgggaat
aggactgaggtttctagtgtgtctgctgtagacctgggttctaaattagtagaagaagct
gttttaaattcaaaaacaagaaaagagactcagtcaacttccaaacaaacacaccttcca
gaaagcaagaataaccctggttctgctgtgccaaacaagtcctctgagcaggaaaagggt
tcagaagaacatatttcatccatctcagcatctactgcaaatgcgctgccgggtctctgt
gaagaggagcccttgtgtgaggattaccgtacacctgaaagcttttgttccgggaaaccc
aaaaaagtttctaagaaatctaaacgtgttcgagaagtgaatgaagtcctaaaagcgcaa
cccgctcacctcccagccagcaatcggctgatgacgagagcgctgagggccatgtgcgat
cctacaaaacaggacatagttggaaagaaagctgaacaaaaacagatcctcaaatctttc
agaaagactaatcatgttaggaagaatcataaaaccaaactggagttttatacgaaaata
aaagctttgaaatcccaccatcctgacaaaagcgaatgtgatcagggcaaaatttctagt
agtagctccccctctctaatgttttccgattccagtgactttgaggatgtcaagagtgaa
gatgaagacctttcaatatcctcaactccaccgatggacttcataccgcttacttcaaaa
gtcaaaacaaagcacgaaggtcaatcctcagacatatactcgccatctcctccatcgccg
ttttcctttctcagagctttcaaaaacgtggaggaggtttccttccagtcacttggggct
gacagaggtggtaagcccatttctttcaagccaaagccaaactgcaggttcagcacattt
ctcatgatgttgaaggacttgcatgacaccagggagcgtgatggagcgccactagagctg
gagatcggaccaccgagcgcacatgttaagaaggagccgttggtgatgccaggagaagct
gcatctgcaggaggggatcaagagactacatgcgctctgaccgattcaagtgcaatccca
gacaaaagcgtagaagccctgaatgaaggaggtgcaagtcagacaccaaagaagtcctcc
aaccgaagaaccaactctggttggttcaaaagtaaacccaaccgcagggcgccttgctct
cctgccaagtctggacccggttttccaggcctggagtctctttcagaaatgatgccggca
gaggactccttggaagccatggagtggtcatcaagagttgtggacttccagagcagcagc
tgggatgagccaggtggagggagtgatgcggttggggcagaacaacaggaggagaaccca
tggagcatggcaaagcagaatctaacagccccgctgcttttggagcagagagaacgtgac
acggcggaggaacagccagactgcctcgtttcagacttcatcaagagagattcaagcttc
gcgaacatctctggagaagacgacaaggcggtaggagcgcataaacgggtaagaaaaccc
agcaagaggctgattgaatggaccgaagagtacgagcaaattttcggcacgaggaagaaa
accaaaaagcctctccagttgattggaaaggccagtcccacacccgttacctcggcacca
gaacctctggactctgacaacaacacaagcgaccgccccccctcgactgcgctccctgaa
atacagaccccgccccctgaggaaatcgctgcaacgacaccaccggaactacaaattccc
agcagccagcacaccaaacccagagacactccggtgctgtccactgacacgctgacaccc
ccacctgaggtggagcccctgctgtcagaagtgtctcctaaagacaacaaggaagtaagt
ctgcctgtgctggaaaagaagcggaagaggaaacccactcagaagattctggagtattgt
ctggaagcagaggcttcaaccggcccaaagaagaagatcaaaggacttagaaataattca
agttctaccgctcattcagattctgctccaccactattaaaactgaagagtaaagcagct
ttgaccccaacgccaacctctgaggtcaccccctgcccacccacaccctccattcagatc
aatcacagagccgctctgcccccccatccagctccttctccccctgagcccaggcagttg
gagacagcaaaggcagatgctcctccggctgaggaccagaacatcccagatgaccctaag
gatgtgtcagagggagagggcgaccagtgcagcccggaccacagcttttcctctgcaaag
gacgacttcggactctgtgacgactcggttttaccggccaggaagatcattggggacaga
ggtggaccggcgtccatgaaagaaaccatatgtcaggtgtgtgagaagaccggggagctg
cttctctgtgagggccagtgctgtggagccttccacttggcctgcatctctctggccgac
gcccccaaagggaagtttgtctgtccggagtgcaagtcaggcgtccacacctgctttgtg
tgtaagaagcgaggcgaggacgtgcgccgctgcatgattcctgtgtgtgggaagttttac
cacggagagtgcatcacaaaccacgccccaaccgcccccgtcaaccgaggtttccgctgc
tccatccacgtctgcctcacctgcttcatcgccaatcccaacagctcgtccatctctaaa
ggccgcctggtgcgatgcgtgcgctgcccagtggcctatcatgccacagacctgtgcatg
gcggcgggcagcgttgtgctctccagcaacagcatcgtctgccccaaccatttcacccct
cgccggggggtcaagaaccacgagcacgtcaacgtcagctggtgctttgtctgcacagaa
gggggaagcctcctgtgctgcgagtcctgtcctgctgcatttcaccgggagtgtctcaac
atcgaaatgcctaaaggcagctggtactgcaacgactgcaaggctgggaagaaaccacac
tataaggacatcctgtgggtaaaggtcggacgctacaggtggtggcctgcagaggtcagc
catcccaaaaccatcccagagaacatccagcggatgaggcacgatgtcggcgagtttccc
gttcacttcttcggttccaacgactacttgtggacctaccaggcgagagtcttcccctac
atggacgtggacgccaacagcaaagaaaagatggggaaaggcgttgacaccacctacaag
aaagctttggaggaggctgctgtgcgattccgtgagctgcaggcagaaaaggagctccga
cagcttcaggaggacaggaagaacgacaggaaaccgccaccgtacaaacacataaaggtg
aaccgacccataggaaaggtgcagatcttcactgcagacctgtctgaggttccacgctgt
aactgcaaggcaacagacgagagtccatgtgggtcggactcagaatgcatcaaccgcatg
ctgctgtacgaatgcaacccgcaggtttgcccggcgggggaaaagtgcctgaatcaggcc
ttcaccaagcgtcaatacagccaggtggagatcttcaggacgctgtcccgagggtggggg
ctccgctgtgtccacgacatcaagaagggccagtttgtcagcgagtacgtgggggaggtg
atcgacgaggaggagtgcaggtccaggatcagacatgcgcaggagaacgacatctgcaac
ttctacatgttaactctggacaaggaccgaatcatcgatgccggtccgaaggggaacgag
gcccgtttcatgaaccactgctgtcagccaaactgtgagacccaaaaatggacggtgaac
ggagacacccgggtggggctgttcgctctcgttgacgtcaaagcaggcacggagctgacc
ttcaactacaacctggagtgtctgggaaacgggaagacggtgtgcaaatgtggagctccg
aactgcagcggcttcctgggtgtgaggccgaagaacaaccctccctccgatgataaaggc
cgtaagatgaagaggagaggccacggcaggaggaagaagaaggtggtgttggccaaagag
cgagaagacgagtgtttcagctgtggagatggagggcagatggtttcctgcaagaaacct
ggatgtcctaaagtctaccatgcagactgcctgaacctcaccaagaggcctgccggtcgg
tgggagtgtccgtggcatcagtgcgacgtttgcgggaaggaggcggcgtccttctgcgag
atgtgtcccagctcgtactgctgccagcaccgcgacggcctgcttttcatctccaagctg
gacgggaagctgtcctgcagcgagcacgacccctgcgggccggagccgctggagccgggg
gagatccgcgagtacaaccccgctcccagagccctcacctcgggtctgggcatggccgtc
atccccgccgccgccgcttccagctccgccaggagcctccgccagaccgacaggggcgcc
cacgaggggggtgacggaggaggcgccggcgagcctttccctcctttctccatcaaagtc
cccatcaccattccagtcgctcctcccgctgcttcgcccccccacaccgacactcccagc
agccccttccacctcccgcactactcacccatctcctcctacgaggaggagagggatgtc
tttgaggaggacgaagaggagctgctggaagactcccacgatgacggagaggcggtgatg
gaggaggaagaggaggaggaggaagggctggactacttggagctggaagaggagcaggag
gaggatgaagatgaagaagaatga

DBGET integrated database retrieval system