KEGG   Oryzias latipes (Japanese medaka): 101161187Help
Entry
101161187         CDS       T02443                                 

Definition
(RefSeq) PC3-like endoprotease variant B
Organism
ola  Oryzias latipes (Japanese medaka)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 409 aa AA seqDB search
MYDDHCGADGYINSIYTISIGAITQSGKPAFFGEPCAGVMAVTPTGSGYGDYQPLVTLTT
TGDGCVTHFPGTSSAAPIAAGILALALEVNPALTWRDVQHLIANTAKIPDPEEPGWSINA
AGYHVHHRYGFGVLDAGLLVQQAALFQKVGRQRTCTQEVAFDSPRIFSPGDSVTLRIHSD
GCQWTSNEISSLEHVQVRLGVSARCRGDLSVSLESPGGTVSMLLDSRPNDASTAGLKNWT
LMTVHCWGEQPRGHWTLKVTDHKGEVWRCTRQHEEEPAGALLTATLILYGTYHSHQSSPE
GPLYSIVSMGSRHPIPGGGLHRRARPPPLDLLHWVYQMERDRKVRAADIIVPARHEKLET
PADRTANFLKLLTSREALKLHSACLLQRSSARSSPAAGELPEQGLSRRV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgaccactgtggtgcagacggttacatcaactccatatacaccatttccatc
ggagctatcactcagagtggaaagcccgcctttttcggtgaaccatgtgcaggagtgatg
gctgtcactccaacaggcagtggctatggagactatcagcctctggtaactctgaccacc
acaggtgatggctgtgtgacccactttccaggaacttccagtgctgctccgattgctgct
gggattctggctcttgccttagaagtaaatcctgcattgacatggagggacgttcagcat
ctgatcgccaacacagcaaagatccccgaccctgaagagcctggctggagtatcaatgca
gcaggataccacgttcaccacaggtatggctttggagttttggatgctgggttgttggtg
cagcaggcggcactcttccaaaaggttggacggcaaaggacgtgcacacaagaagttgca
ttcgactcacccagaatcttctctcctggagacagtgttacgttgaggattcactcagat
ggctgtcagtggacatccaacgagatcagctctctggagcatgtgcaggtgagactgggt
gtttccgccaggtgtcgtggtgacctctctgtaagtctggagtctccaggcggcacagtg
tccatgctgttggattcgcggcctaatgatgcctccactgctggcctgaagaactggacg
ctgatgacggtgcactgctggggggagcagccacgaggccactggacgctcaaggtgacc
gaccacaaaggcgaagtgtggagatgcacgaggcagcatgaagaggagcctgctggagct
ttactcactgccaccctcattctgtacggcacctaccactcacaccagagctcgcctgag
ggccccctgtatagcattgtatccatggggtcccgccaccccatccccggcggtgggttg
caccggagggcccgccccccacctctggatctgcttcactgggtctaccaaatggaaaga
gataggaaagtgcgggctgctgacatcatcgttccagccagacatgagaagctggagact
cctgctgatagaacggctaacttcctcaaacttctgacatcaagggaagcattaaagctt
cattcggcatgtcttctacagaggtcctccgcgagatcaagtcctgccgctggagaactt
cctgagcaaggactgtcaagaagggtgtga

DBGET integrated database retrieval system