KEGG   Oryzias latipes (Japanese medaka): 101161417Help
Entry
101161417         CDS       T02443                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L-like
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Tight junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101161417
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    101161417
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101161417
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101161417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 2905 aa AA seqDB search
MDQKIQSRTATPTPLLSDAPTVDREKEGGGGKKEEEDEKNRDREKERTTAAPAGAGGAGE
GGSEGVNGDQSHFSIKESSLSEGNVKLKIGLQAKRMKKPPKILENYVCRPAFRATVRHTN
RGGGGARGNRAAAAADGQRREGQSPSQGREKDKEKSPSVSKPPSSSSTLPSKTSAPPSPA
PPSGCTNPPSSQVNGSAPVKRVPGMDGKTESKSDAKAATAPPERPLNLHRPQPENKPHSS
GKKTLTQQTPPQTSSPSSSLPALKEPTFEGVKPPQYTYSSEGQKDKDKGGQSWGSPTVTE
KLAQLIATCPPSKALKPIKLSKTDPASTTLPSSGFMAPTAKQRDRAMANRNTYSRMMHLS
PPPPVSRPPGRPYGSRSKDGIPENVSTAQRKDDSDGSGKSCSSNNSGSVRSSSPAFTYGN
NWLPTMTKDSSNENGKISISVPQSCFAHSFPQTTSSSSCPVSPSSSNSADPRTSSSGSSS
GLSQGQHARDFSATAEENGAHEREQDSDNPRDLTKCPPPATTGRPEVKEKGANGHGEQGK
SCSPSKRSPNRDSIHSGRYSSSPEPVRQREFSPPEMDDEEGSETPPRDDSLDSSMDSSTE
QDSRPLKKRKGRKPRWSCDMNKTHSKSMKGHDSPCGDSKNTMLFSSDMETPSPPVKRPVG
RPPNPNKLRQNTMPQSTVSQFFSSQPKKRGRPKSKMPRLDAPGPGNSPCKLSHSKVFSSL
LKSKEEQDPPVLHPEVDLNPPKPLPRKRGRPKRPPTLPQEGQPPTLAPEEDDVGEQRFHS
KGNGQLIMKTIIGKINKMKSVKRKRILSQILLGPRTEDPPKGNTSGMVGSVEAATQSLSS
LAATFGGKLGPQINVSKKGTIYMGKRRGRKPKAAGSTSSPEPFLSPNTASPLSHQSQSHY
LFSSDVFPSPSLSQSSGGHSPISEASFVEPGSVHFGGHTHYSSSHHSHNTFSFPTPTFSA
PNKMLGSVSSSAVTAASQKKSSYRGYPLHHHHYRQHHHYHRLSPPRPIHPTSPAPLNELK
EATPSPVSESHSEETVPSDSGIGTDNNSTSDRGEKAGGMGGLGLPPGMGGGLLMPGVMSS
AVVSGLSINSRGRRRHSAGLVDRPSPSPSPHGVRSSPDPRRPHPAVPASSLLGHKDKHKH
KCKRRSHVCPGYDKLKRQKRKRKKKYLQLRSRRLDPDFLAELDEIIVMLSEVRITHRTTG
HRLGGGIGIAAGASRMPGLGSRGSSGMGGPGGPPPHPYVHRDLLPTIFRVNFGRFYSHPA
YSCDPFHYIRKPDMKKKRGRPPKLRESMSEVPFVPGLGFPLSSGGFYHPPYGVPYSSGPL
GLGYYRGYPSTSSLYAHPHHQSPHTPQSHHSHHSPTFPPPPPTTSYMHHHHPSHLLLNPS
KFHKKKHKLLRQEYLGGGRSPVLFPSLSSELSFNWHHKHKHRHKHRERCSEEDREEAARS
GSGGRSAAGIPDKGTSGKTDPVGGLGMSETLQRCRFGRDSSSTPASKQPVARSANSPLSS
SAERFKRKESSMSCLGPSRLTLGNSWFRIGSSEADYSKISQSIVAPSQGSFSDERGGDPS
GCSDSEDEERLTPRQDVDSHGSPDLTNLFSSALTRASFRGNRSRNTDVTESSNFSQVDRL
MRKDPSTSSERREFGTSGNPTRGVPLSPSKGPEGALHHRQPLYHHPALFHSHGSAASQDC
CLEASLPHRSYRVQPSKHSLHHVNKILRAKKLQRQARTGNNVVKKRGPGRPRKYPLLSPP
PSSPPAVEANDARPRDRGGDRLPEGRGWEGDTVTDAIESVVQGQSRKTPKRKHWDKDDDE
EEEEEAENKDVEEMVDLPPIREENQDENLAARSRPGTGRSWPALEEHQNFQSSAERKPEG
HRSPEHGGAVPREQAPPMPVTSQREKRPARPPKKKFQKAGLYSDVYKTEDPRSQLLQLKK
EKLEYIPGEHEYGLFPAPIHVGKYLRQKRIDFQLPYDILWLWKHDQLSKRPDVPLYKKIR
SNVYVDVKPFSGYETTTCSCKPPENSDDKGCLDDCLNRMSYAECSPSTCPCGEQCDNQHI
QRHEWVQCLERFRAEGKGWGIRTKEPLRAGQFIIEYLGEVVSEQEFRSRMMEQYFSHSGH
YCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLFALKDVSSGTELTY
DYNFHSFNTEEQQACKCGSESCRGIIGGKSQRINGLPGKTGGARRLGRLKEKRKSKHQFK
KREEDSSDNNKFYPHLMKPMSNRERNFVLKHRVFLLRNWEKMREKQELQKREGDRDASSL
SIYTRYGGVTRDDGNIKSDVFQTQFSALQTLRSVRTRRLAAAEENTEVTRTARLAHIFKE
IWEMITGYKDSAGQALAAPLMNLPSRKRNSQYYEKVSDPLDLNTIEKQIVTGHYKTVEAF
DTDMLKVFRNAEKYYGRKSPVGRDVYRLRKAYYSARHEAAVQIDEIVGETSSEADSSDSL
ERDHGHHQHGEGPHDKDDDVIRCICGMYKDEGLMIQCEKCMVWQHFDCMRLETEVEHYLC
EQCDPRPVEREVPMLPQPSYAQAGSIYYICLLRDDLLLHQGDCVYLMRDSRRSSEGQPVR
QSYRLLSHVNRDKLDIFRIEKLWKNEKGERFAFGHHYFRPHETHHSPSRRFYQNELFRMP
LYEIIPLEAVVATCCVLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVC
TKPYAFVHFTKRLAPKRDFSPHYVPDNYKRNGGRSAWKSERSKEPGRCDDDDASCDRGED
FPAEAEGGRGGGDDVDTAAEDPDFVPTKPTPAETGRGEEEEDDEEEEEEEEDRQEARVCK
ELEEGSNQRMGEMLELPTPLSSSPPQHRALSRREAQRDRLNKILLDLLHRIPNKNAIDVT
YLLEEGAGRRLRRRTLGFGDFVFRK
NT seq 8718 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaagattcagagtcgaactgcgactccaacccctctcctctccgatgccccc
acggtggatcgagagaaggaagggggcgggggaaagaaagaagaggaagatgagaaaaac
cgggatcgagaaaaagagaggacaactgctgcccctgccggagcaggcggtgcaggtgaa
ggtgggtccgagggggtcaacggcgaccaatcccacttctccatcaaagagagcagcctg
tctgagggcaacgtcaagctgaagatcggccttcaagccaaacgcatgaagaaaccccca
aagatcctggagaattatgtgtgccggccagcctttagggcgaccgtgaggcacacaaac
cgcgggggaggtggtgcccgcggtaaccgagcggcggcggcggccgatggacagcgtcgt
gagggccagagtccttcacaggggcgggaaaaggataaggaaaaaagtcccagtgtgagc
aaaccaccgtcgtcttcctccaccctaccctctaaaacatctgcacctccttctcctgct
cctccgtctggctgcactaatcccccgtcatcccaagtgaatgggagtgctccagtaaaa
agggttcctggaatggatggcaagacggagtcaaagtcggatgcaaaagcagcaactgct
ccaccagagagacccctaaacttacatcgcccccaaccagagaacaaaccccattcctcg
gggaagaaaacactgactcagcaaacacctccacagacttcttcgccgagttcatcacta
cctgcattgaaggaacccacctttgagggtgttaagcctcctcaatacacctacagttca
gagggccagaaagacaaggacaaggggggccaaagttggggatcccccactgtcacagaa
aaattagcccagcttattgctacttgccccccatctaaagctttaaagccaatcaagctg
tcaaagactgatccagcttccaccaccctcccaagctcaggcttcatggctcctacggcc
aagcagcgggatagggccatggccaacaggaatacatactcaagaatgatgcatctgtct
cctcctccccccgtatcgagaccccctggtcgcccctatggttcaagaagcaaagacggc
atcccagaaaacgtttccacagcacaaaggaaagatgactcggatgggtctggaaaatct
tgtagcagcaacaacagcggtagcgtgcgcagcagcagccctgcgttcacctatggcaat
aactggttgcccaccatgacgaaggatagcagcaacgaaaatgggaaaattagcatctct
gttccacagtcgtgctttgctcatagttttccacagaccacatcctcatcatcgtgccct
gtttccccctcttcttcaaactcagctgatccgagaacatcgagctcagggagctcttct
ggtctctcccaaggacagcatgcacgagacttctcagcaacggcggaggaaaacggcgca
catgagagggagcaggacagcgacaaccccagggacttgaccaaatgcccccctccagca
acaacaggaaggccggaggtaaaagaaaagggagcaaatggtcacggcgagcagggaaag
agctgtagtcccagcaagcgcagccctaaccgggatagtattcattcaggtcggtacagc
agttctcctgagcctgtgaggcaaagagaattttctccaccagagatggacgatgaagaa
ggctcagaaacgcctcctagagatgattccctagattcctctatggactcctctaccgag
caggacagcagacctcttaaaaaacgcaaagggagaaaaccccgctggagttgtgacatg
aacaagacccacagcaagagcatgaaaggccatgatagtccctgcggcgacagcaagaac
accatgctcttttcctctgacatggaaaccccatcacctccagtcaaaaggcctgtgggg
cggcctcccaatccaaacaagctcaggcagaatactatgccacaaagtacagtgtcgcaa
ttcttctcgtcccagccgaagaaaagaggaaggccaaagtccaaaatgccgaggcttgat
gcccctggtcccggaaactccccctgtaagctgtcgcactcaaaggttttctcgtctctg
ctgaagtccaaagaagagcaggacccacctgttcttcacccggaggtggacttaaatcct
ccaaaacctttgcccagaaagcgtgggcgtcctaaacgccctcctacattacctcaagag
gggcagcctcctaccctggctccagaagaagacgacgtgggggaacagaggttccacagc
aaaggaaatgggcagctcatcatgaaaaccatcattggcaaaattaacaagatgaaaagt
gtgaagaggaaacggattctgagccagattcttttgggtccgagaacagaagaccctccc
aaaggcaacacaagtggaatggttggttcagtggaagctgcaacccagtcattgtcatct
ttagctgctacttttgggggaaagcttgggccgcaaattaacgtcagtaaaaagggaaca
atatacatggggaagaggagaggccgtaaaccaaaggcagccggttccacatcatcacca
gaaccttttctgtctccaaataccgcttcccctctttctcatcaatctcagtcccactat
ttgttctcctctgacgtatttccttctccctccctctcacagtcgagcggaggccacagt
cccatcagtgaagccagctttgtggagcccggctcggtgcactttggaggtcacactcac
tattcgagctcgcatcatagccacaacacgttctccttcccgacaccaaccttttctgcc
cctaacaagatgctggggtctgtgtcatcctctgcagtcacagcagcttctcagaaaaag
tcgtcttacagaggataccctctccaccaccaccattaccggcagcaccaccactatcat
aggctttctcctcccaggccaatccaccccacctcccctgctcccctcaatgagcttaaa
gaagcaaccccttccccagtcagcgagtcccacagtgaggagacggtgcccagcgacagt
ggcatcgggacagacaacaacagcacatctgatcgtggcgagaaagctggtggaatgggg
gggttggggttgccgcctggaatgggaggtggattgttgatgccaggtgtgatgagttca
gctgtggtttccgggctgagcatcaactccagagggaggcgccggcactctgccgggcta
gtagaccgtccctcaccctccccatcgccacacggagtgcgatcgtcccccgatcccaga
agacctcaccctgcggtgcccgcctcctcattgttgggccacaaggacaaacacaagcac
aaatgtaaacggcgtagccatgtgtgtcccgggtacgacaagttaaagagacagaagcgg
aaacgaaagaagaagtacttgcagctgcggtctcgccgccttgacccagactttctggct
gaactcgacgagataattgtcatgctgagcgaagtacggataacccaccgtaccacggga
caccggctgggcggtggaataggcatcgccgcaggagcaagcagaatgcccgggttgggg
agcagaggaagcagtggaatgggaggaccaggaggtcctcctcctcatccttatgtgcac
agggacctcttaccaactatattccgggttaactttggcaggttctactcccatcctgcc
tactcctgtgacccctttcactacatccgtaaacccgacatgaagaagaaacgtgggcga
ccccccaagttaagagaatccatgtctgaagtcccgtttgtacctggtctagggttccca
ctctcaagtgggggtttctaccacccaccatacggcgtcccttattcatctggacccctg
ggtttgggttattacagaggttacccttcaacaagttccctgtatgctcaccctcatcac
cagtctcctcacacaccacaatcccaccactcccaccattcaccaaccttcccgcctcct
ccccccaccacgtcttacatgcaccaccaccacccctctcatctcctgttgaacccctcc
aaatttcataagaagaaacacaagctgcttcggcaggagtacctgggaggagggaggtcc
ccagtccttttcccgtcgttgtcttctgaactttcctttaactggcaccataaacacaaa
cataggcacaaacatcgagagcgttgttctgaggaagaccgagaggaagcagcaaggagt
ggatcaggtggccgatccgccgctgggattcctgacaaaggaacatcaggtaaaacggat
ccagttggtggtttgggaatgtcagagactttacagagatgccgctttggtagagacagc
tccagcacccctgccagcaagcaacctgttgcccgttctgccaattcccctctgtcatca
tcagcagaacgcttcaagcgtaaggagagctccatgtcctgcctaggaccctctaggctc
acgctggggaacagctggttcaggataggcagttctgaagcggactactccaaaatttca
cagagcatagtagcacccagccagggttcattctcagatgaacggggaggagatccgtca
ggatgttctgacagtgaagacgaggaacgtctcactcccagacaagatgttgactctcat
ggttctccagatctaacaaatttgttttcctcggctctaactcgggcttcgttcagagga
aatcgtagcaggaatactgatgtcacagagagctcaaacttctcccaagtggatcggctt
atgaggaaggatccatcaacgtcatcggagaggagagagtttgggacttcaggaaatcca
accagaggtgttcccttatccccctctaaagggccagaaggagctctgcaccaccgacag
ccgctctaccaccatcccgctctgttccactcccacggctcggcggcgtctcaggactgt
tgcctggaagcctccttgccccaccgctcctaccgggtccagccgtccaaacacagcctg
caccacgtcaacaaaatcctgcgcgccaaaaagctgcagaggcaagctcgcacgggaaac
aacgtggtaaagaagagggggcccggtcggcccaggaaatacccgctgctctcccctcca
ccatcctcgccgccggcggtggaggcgaatgatgctcggccaagggacagaggcggggac
aggctaccagagggaagagggtgggagggcgatacagtcactgacgctattgagtcagtg
gtccagggccagagcaggaaaactccgaaaaggaagcactgggacaaggatgacgatgaa
gaagaggaggaggaagcagagaacaaagacgtagaagaaatggtggatctaccaccaatc
agggaagagaatcaagacgaaaacctggccgcaaggtccagacccgggacaggaaggagc
tggcccgctctagaagaacatcagaactttcaaagctctgcggaaaggaagccagaaggc
catcggtccccggagcacggaggggctgtccccagagaacaagctccgcccatgcctgtt
accagccagcgagagaagagaccagcaagacctccaaagaagaagttccaaaaagccggc
ctgtactcagacgtttacaaaacggaggacccccgcagtcagctcctgcagctgaagaag
gagaaacttgaatacatacctggggagcacgagtacggactgtttcctgcaccgatacat
gttgggaaatacctgagacagaagcgcatcgacttccagctgccgtacgatattttatgg
ctgtggaaacacgatcagctgtctaagaggcctgatgttcctctttacaaaaagatcaga
tcaaacgtctacgtggacgtgaagcctttttccgggtatgaaacgacgacctgcagctgc
aaaccgccggagaactcggacgacaaaggctgtttagatgattgcctgaacaggatgagc
tatgcagaatgttctccgagcacgtgtccatgtggagagcagtgtgacaaccagcacatt
cagagacacgagtgggtccagtgtctggagcggttccgcgctgagggaaagggttggggt
attcgcacaaaggagcccctccgagcggggcagttcatcatcgaatacctgggagaggtg
gttagcgagcaggagttcaggagccgcatgatggagcagtacttctcccacagtggccac
tactgtctcaacctggacagcggcatggtgattgacagctaccgaatgggcaatgaggcg
cgcttcatcaaccacagctgtgacccaaactgtgaaatgcagaaatggtcggtgaacgga
gtttaccggatcggtctctttgctctgaaggacgtcagcagcggcaccgaactcacctac
gactacaacttccactccttcaacacggaggagcagcaagcctgcaagtgtggctcagag
agctgccgcgggatcatcggcgggaagagtcagcggatcaacggcctgcccgggaaaacg
ggaggcgctcggcgtctggggcgactcaaggagaagaggaagtccaaacaccagttcaaa
aaacgggaggaagattccagcgacaacaataagttttaccctcatctgatgaagccgatg
tccaacagagagaggaactttgtcctgaagcaccgagtttttcttctgaggaactgggag
aagatgcgggaaaagcaggagctgcagaagcgagaaggcgacagagacgccagcagcctc
tctatttacacgcgatacggaggagtcacccgagacgacggcaacatcaaatcagacgtg
ttccagacgcagttctcggctctgcagacgctgcggtcggttcgcacgcggcggctggct
gctgccgaagaaaacacggaggtgacgcggaccgcacggctcgcgcacatcttcaaggag
atctgggaaatgatcacgggctacaaggattcagcaggccaggccctcgccgccccactg
atgaacctcccgtccagaaagaggaacagccagtactacgagaaggtgtctgatccgctg
gacctgaacaccatcgagaagcagatcgtaaccggccattacaagacggtggaggcgttt
gacaccgacatgctgaaggttttccgcaacgctgagaaatactacggccggaaatccccg
gtgggccgggacgtttaccggctgcggaaagcctactacagcgctcgccacgaggccgcc
gtccagatcgacgagatcgtgggggaaacgtcgagcgaggccgacagctccgattcgctg
gagcgggaccacggtcaccaccagcacggggaaggcccccacgataaggacgacgacgtc
atccgctgcatctgcgggatgtacaaagacgaaggcctgatgatccagtgtgaaaagtgc
atggtgtggcagcactttgactgcatgcggttggagacggaggtggagcactacctctgc
gagcagtgtgacccccggccagtagaacgggaggttcccatgttaccccaacccagctac
gctcaggccggctccatctactacatctgtctgcttagagacgacctgctgctgcaccaa
ggtgactgtgtgtatctgatgagggacagcaggcgctcatctgaagggcagccggtccgc
cagtcctaccgcctgctgtcgcacgtcaaccgggacaagctggacatcttccggatcgag
aaactctggaagaatgagaagggggagcggtttgcgttcgggcatcactacttccgccct
catgagacgcatcactccccatcgcggcggttctaccagaacgagctgttccggatgcct
ctgtacgagatcatccctctggaggcggtggtggcgacctgctgcgtcctggacctctac
acctactgcaaggggagaccgaagggcgtgaaggaacaggacgtctacatctgtgactac
cgcctggacaagtcggcgcacctgttctacaagatccatcgcaaccgctacccggtgtgc
accaagccgtacgccttcgtccacttcaccaagaggctcgcgccaaagagggacttctcg
cctcattatgttccggacaactataagaggaacggcggccgatcggcgtggaaaagcgaa
aggtccaaagaaccgggacgctgcgacgatgacgacgcctcctgcgaccggggggaggac
ttccccgccgaggcagaagggggaagaggagggggggacgacgtggacacggctgcagag
gaccccgactttgttccaaccaaacccacgccagccgaaacgggaagaggggaggaggag
gaggacgatgaagaagaggaggaggaggaggaggacaggcaggaggctcgggtgtgcaag
gagctggaggaaggttccaaccagaggatgggggagatgctggaactcccaaccccgtta
tcctcctccccccctcagcacagagctctcagcaggagggaggcccagagggaccggctg
aacaagatcctgctggacctgctgcacagaatccccaacaagaatgccatcgatgtcact
tatctgctggaggagggagcgggacggcggctccggcggcggacgcttggattcggagac
tttgttttcaggaagtga

DBGET integrated database retrieval system