KEGG   Oryzias latipes (Japanese medaka): 101161500Help
Entry
101161500         CDS       T02443                                 

Definition
histone acetyltransferase KAT5-like
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101161500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 542 aa AA seqDB search
MADNCSSVEIVEGCRLPVLRKNQEHEDEWPLAEILSLKEVSGRKLFYVHYIDFNKRLDEW
VTADRLDMKKLQFPKKEAKTPTKNGLSGSRPSSPERAEREVRKTLDLNLQSATAPSRGKT
LPTPKRKEVVPLVTPVPPATPVPALPSSTETSQAAVFPVVREPPPFKAREDLEPIPTVTT
NGTARRLIPPQPGRKRKANCGGPDEMIKVLQYNKPQSAAVFLPPPEDSQDSSDGIPTAPR
MTGSLVSDRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLK
SLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYSQNLCLLAKCFLDHKTLYY
DTDPFLFYVMTEYDSKGFHIVGYFSKVXEEXEDYNVACILTLPPYQRRGYGKLLIEFSYE
LSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPDNGERPQITINEISEITSVK
KEDVISTLQYLNLINYYKGQYILTLSEEIVDGHEKAMQKRHLRIDPKCLHFTPKDWSKRG
KW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaactgttcttcggtcgaaattgtggaaggctgtcgcctccccgttcttcgt
aaaaaccaggaacatgaggatgagtggcctttggctgagatcctgagtttgaaggaggtt
tctggaagaaagctgttctatgttcactacattgacttcaacaagcgcttggatgaatgg
gtcacagcagacaggctggacatgaagaagctccagtttcccaaaaaagaagcaaaaaca
cccacaaagaatggactgtcaggctcgcgtcctagctcaccagaaagagcagaaagagaa
gtaaggaagactctagatctcaacctccaatctgccacagctccttccagaggcaaaacc
ctccccacgccgaagaggaaagaggtggttcccctggtgactccggtaccacccgccacc
cctgtgcccgccctgccgagctcaactgaaacctcccaggcggctgttttccctgtcgta
agagagcccccccccttcaaggcgcgggaagaccttgagccgattcccacagtcacaacg
aacggcaccgcccggcgtctaataccccctcagcctggtagaaagaggaaagctaactgt
gggggtcctgatgagatgataaaggtgttgcagtataacaagcctcaaagtgccgccgtc
tttctacccccaccagaggactcccaagacagttctgatggtataccgacagcaccccgc
atgaccggcagcctggtgtcagatcgcagtcacgatgacatcatcacccgcatgaaaaac
atcgagtgcatcgagttaggccggcacaggctcaagccgtggtacttttcgccgtaccca
caggagctgaccactctgcccattctctacctctgtgaattctgcctcaagtacctgaaa
agcctcaagtgtctccagaggcatctgactaaatgtaatctgagacatcctccaggcaat
gaaatctaccgcaaaggaaccatatccttctttgagattgatggcagaaaaaacaaaaat
tattcccagaacctgtgcttacttgcaaagtgtttcctagaccacaagacgttatactac
gacactgatcctttcctcttttatgtgatgacggagtacgactccaaaggcttccacata
gtgggatacttctctaaggtataagaagaanctgaagattataatgttgcttgtatcctc
accttacctccctaccaaaggagaggctatggcaaactgctcatcgagttcagttatgag
ctgtccaaggtggaggggaagacgggaactccagagaaacctctttctgatctcggtctt
ctgtcgtatcgttcctactggtcccaaacaatccttgaaattctgatggacttgaaacct
gataacggagaaagacctcagattaccatcaatgagatcagtgagataacgagtgtcaag
aaagaagatgtcatctcaacacttcagtacctcaacttaatcaactattacaagggacag
tacattctgaccctttcagaggaaatagtggatggacacgagaaagcgatgcagaagagg
cacctgcgcatcgatcccaaatgcctgcactttactccaaaggactggagcaaacggggg
aagtggtag

DBGET integrated database retrieval system