KEGG   Oryzias latipes (Japanese medaka): 101161556Help
Entry
101161556         CDS       T02443                                 

Definition
nuclear receptor coactivator 3-like
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101161556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1484 aa AA seqDB search
MSGLGENSMEPLSSENRKRKLSTCDTPALGSERKRREQESKYIEELAELISANLSDIDSF
NVKPDKCAILKETVRQIRQIKEQGKSSSNDDDVQKSDVSSTGQGVIDKDHLGPLLLQALD
GFLFVVNREGSIVFVSDNVTQYLQYKQEELINTNVYNILHEDDREEFHKNLPKSSINGVS
WGNEPVRQKSHTFTCRMLVKFGHAHGPMEEGPGGPRYETMQCFALTQPKAMIEEGEDLQS
CMICVARRVTAMERTESFNTRHELSGKLIQIDQNSLRASMRPGWEDLLRRCIQMFLQHSD
GQPWSHKRHYHEAFLQGHAETPLYRFSLSDGTPVTAQTKSKLYRHPMSNEPQGFISTHLL
QREPNGYRSAPGGGMMSNSMRQQGMGGPSPNTQMNVNPGGGMGMGGMGGMNRGFSMNEQG
HMAHMAPMGGGSMYGGSGGAGGGGGGMGNRVMQMNQMGQMNPVGHMNHPGQGMQPHPQQP
PFQNSGGFGLSGMNSPSGSPRIGGPQQGFLMSPRNRGSPKMGANQFSPGGMHSPMGSIGS
GGAGGGGTSTFSSSSLNALQAISEGVGSSLSSTLTSPPPAHKPDSSPSIHSSSSSSQPNQ
QGKPSQDGCKSPTGGLGPGDHHLSTHHHHHQQHPAESSADRPDSQAATSTKESGEGSGEA
GVTNSESQRRLPDSKGHKKLLQLLTSPTEELGIGGSGTSGPPVPPPNSSRNDVGLDCKDA
SGGMTSPSSTGVSSSSAASSQAAGQGTSLSLSLSSANYTGSLQEKHKILHKLLQNGNTPD
EVAKITAEATGKVSLGGQESSEAAASISGPGLGSGFTADSKQEQHSPKKEKTHALLHYLL
NKDDSKEPVDVKPKLEELEGKGPPGPTGGPLPEHPESKIKSEPSDDLHNLESILGDLRGS
SSDFYPDLAGGGVANRAGNKPQGCLDDGLQGSPVLGPGARGPFQRTLSMDGKPSIAPGGA
GRRPMLIKQEKMMGSPDSYPGNLGPINRGVVPQRSPMGGSGDWGMPCSNASAAGSAGHPS
MMRPGMEYNSGKSMMPGPMVGRSNSVPGSRSMLQQQLMDMGGSSDMGIGMSPFSQQGQPT
PSPSWPDSMMSMEGNRRQFGNSLDDLLVPPTTSEGQSDERALLDQLDSLLNNTDGIALEE
IDRALGIPDLVSQNQGPETLEPFPGQDQAMLLDQKPLYGQGYPGPPSMPMQSGYGGNPMQ
GQGQQGGFGPMLSQMGQGGNFPGMAGMGGMGNPRANMMRPRMMSPNKPMRLQLQQRLQGQ
QPGFLNAQMMAQRSREVVTMQMRRQRMMMFMQQQQQQAAAAAAAGGFSPPPNVTAPGGMD
SPMGGPNMAQPGPQQFGYSSSYGMAQQGDPSFGPSGGSPPNAMMPGRLGPQNPMMQQHSQ
GGPMYQGPDMKAWSQGGVGRNSASYPQQQFGQQGNPAQYGGMMMNGAMPSSGGGGHMGQM
GGQMGMNPMVMGRMPMGPDQTGDLFREYPAFTPVAGWLQQPCDP
NT seq 4455 nt NT seq  +upstreamnt  +downstreamnt
atgagcggactcggggagaactccatggagcctctgagttcagaaaaccgaaaacgcaag
ctgtccacctgcgacacgccggctctgggttctgagaggaagcgacgggagcaggagagc
aagtacatcgaagagctggccgagctgatctccgccaacctcagcgacatcgacagcttt
aacgtcaaaccggacaaatgcgccatcctgaaggagacggtgcggcagatccggcagatc
aaggagcagggaaaatcttcatccaacgatgacgacgttcagaagtcagacgtgtcctcg
actggtcagggagtcatagacaaggaccacttggggcctcttttgctgcaggcgctggac
ggcttcttgtttgtggtgaaccgggagggcagcatcgtgttcgtgtcggacaatgtgacg
cagtacctgcagtacaaacaggaggagctcatcaacaccaacgtgtacaacattctccac
gaagacgacagggaggagttccacaagaacctgcccaaaagcagcataaatggagtgtca
tggggaaacgaaccggtccgacagaagagtcacaccttcacctgtcgtatgctggtcaag
tttggccacgcccacggacccatggaggaggggccaggaggaccacgatacgagaccatg
cagtgctttgctctcactcaacccaaggccatgattgaggagggggaagaccttcagtca
tgcatgatctgtgttgcccgtcgagtcacggcgatggagagaacggagagtttcaacact
cgacacgagctctcaggtaaactgattcagattgatcaaaactccctgagggcctccatg
cgtccggggtgggaagacctgttgagacgttgcattcagatgttcctccagcacagcgac
gggcagccctggtcgcataaacgccactaccatgaggcctttctgcagggtcacgccgag
acgcccttgtaccgcttctctctgtctgacggcactccagtaacggcccagaccaagagc
aaactgtaccgccaccccatgagtaacgagccccaaggcttcatctccactcacctactt
cagagagaaccaaatggttaccgttcagcaccaggcggtggcatgatgtccaacagtatg
cgtcaacaaggcatgggtggccccagcccgaacacccaaatgaatgtgaacccaggtgga
gggatgggcatgggaggcatgggcggcatgaacaggggcttcagcatgaatgagcagggc
catatggctcacatggctccaatgggaggtggttccatgtacggagggagcggtggagca
ggaggcggcggtggaggcatgggcaaccgcgtgatgcagatgaaccagatgggacagatg
aatccggtggggcacatgaatcatccgggccaaggcatgcagccgcatccacagcagccc
ccgtttcagaacagcggcggctttggactcagcggcatgaacagcccatcagggagtcct
cgaatagggggtccccagcagggattcctcatgtcacctcgaaaccgagggagccccaaa
atgggcgccaaccagttttcccctggaggtatgcactcacccatgggtagcattgggagt
ggtggagcaggtggtgggggaacttctaccttctccagtagctcacttaatgctcttcaa
gccatcagtgaaggagttggcagctctctttcctccactctaacctcccctccaccagcc
cacaaacccgacagctctcccagcatccactcttcctcctcttcatctcagcctaaccag
cagggcaaacccagccaagatggctgcaaaagtccaactggaggcttaggacctggtgac
caccacctttcgacgcaccatcaccaccatcaacaacacccggcggaaagttctgcagac
agacccgacagccaggcggcaacgtcgacaaaagagtctggagagggaagcggcgaggcg
ggagtcacgaactctgaatcgcagcggaggttgccggacagtaaggggcacaagaagctg
ctgcagttgctgacttcacctactgaggagctaggaatagggggcagcggaacatcaggg
ccacctgtaccaccaccgaacagcagcagaaatgatgtaggcttagactgtaaagacgcc
tcaggaggcatgactagcccttcgtcaacaggggtgtcctcttcgtcagccgcttcaagc
caggcagccgggcaaggcacgtcactgtcactgtctttgtcatcggcaaattacacaggc
tcacttcaagagaagcacaagatcctacacaagcttcttcaaaacggaaatactcctgat
gaagtagcaaagatcacagcagaggcaacgggaaaagtatctctcgggggccaggagagc
agcgaggctgcagccagcatctctgggcccgggttaggctccgggttcacagcagactcc
aaacaggagcagcatagtcctaagaaggagaagacccatgcccttctccattacctcctc
aacaaggatgattccaaagagcctgtggacgtcaagcccaaactcgaagagttggagggg
aagggccctcctggccccactgggggccccctacctgaacatcccgagagcaagatcaaa
tcagaaccatcagatgatctgcacaacctagagtccatcctgggggatttgagggggtcg
agctccgacttttaccctgatctggccggaggtggagtagcaaacagagcagggaataaa
ccacagggttgccttgatgacggtttgcaaggcagtccagtattgggtcctggagctcgg
gggccatttcagaggaccctgtccatggacgggaagccttccattgcacctggcggagca
ggtagacggcccatgcttatcaagcaggagaagatgatgggcagtcctgacagctaccca
ggaaaccttggaccaatcaacaggggtgttgtcccgcagaggtctcccatggggggttca
ggagactggggcatgccctgctccaatgccagcgctgcaggttcagcaggacacccgtct
atgatgcggcccggcatggagtataacagcggcaagagtatgatgccaggacccatggtc
ggccgctccaacagcgtgccgggctccaggtcaatgctgcagcagcagctcatggatatg
ggtggctctagtgacatggggataggaatgagccccttcagccagcagggccagcccacc
ccgtccccgtcctggcccgactccatgatgagcatggagggcaacaggcggcagtttgga
aactccttggacgaccttctggttcctcccaccaccagtgaaggtcagagtgatgagcgg
gcgcttctggaccagctggactctttgctgaataacacagacggcatcgctttggaagag
attgaccgagctctgggtatcccagacctcgtcagccagaaccaaggaccagagacgctg
gagcccttcccaggccaggaccaagccatgctgctggaccagaaacctctgtatggacag
ggctatcccggccccccttccatgcccatgcagtccggctatggagggaaccccatgcag
ggtcagggccagcaggggggctttgggcctatgctctcgcagatggggcaaggtggcaac
tttcctggtatggctggaatggggggcatggggaacccacgtgccaacatgatgagacca
agaatgatgagccccaacaagcccatgaggctgcagctgcagcagaggcttcagggacag
cagccgggcttcctgaacgctcagatgatggctcagcgcagcagagaggtggtcaccatg
cagatgaggaggcagcgcatgatgatgtttatgcagcagcaacagcagcaagcggcagca
gcagcagcagccggagggttcagccctcctccgaacgtcacggctcccggcggcatggac
agccctatgggggggccaaacatggcccagccgggcccccagcagtttggttacagcagc
agctatgggatggcacagcaaggagacccctcttttggcccatcaggaggcagtcctcct
aatgccatgatgcctggccgcttggggcctcaaaaccccatgatgcaacagcactcgcag
ggcgggcccatgtatcagggtcctgacatgaaagcctggtcccagggaggagttggacgg
aacagcgcttcatatcctcagcagcagtttgggcagcaggggaatccagcgcaatacgga
gggatgatgatgaacggggccatgccgtccagcggaggagggggtcacatgggtcagatg
ggtgggcaaatgggaatgaacccaatggttatgggacgcatgcctatggggcccgatcag
actggtgacctgttcagggaataccccgccttcaccccagtagctggctggctccagcaa
ccctgtgacccctga

DBGET integrated database retrieval system