KEGG   Oryzias latipes (Japanese medaka): 101161586Help
Entry
101161586         CDS       T02443                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101161586
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     101161586
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 555 aa AA seqDB search
MQPFPFFFFSPFLLFLIPSCSTQSEADFIVQTKSGRVRGFQVTVPDQSRPVVGFLGIPFG
EPPVGKRRFRPAEPKRPWQGVYKADSYPNACFQFVDKSYPGFPGIEMWNPNREMSEDCLY
LNIWVPSSVKPHNLPVMVWIYGGGFYSGSSSLDVYDGRYLASVENVIVVSMNYRIGAFGF
LALDGTSEAPGNVGLLDQRMALQWVQNNIASFGGDPRQVTIFGESAGGASVGYHLLSPGS
RPLFTRAILQSGVPNCPWASVTYAEARRRATQLANAVGCNGGNDTELVDCLRGKTPQELI
DQEWQVLPWTALFRFSFVPVVDGEVLPDAPEAMVNSGDFKDTQILLGVNQDEGSYFLLYG
APGFSKDNDSLISRKDFLAGVKMGVPHANDIGLEAVVLQYTDWMDENNGEKNRDAMDDIV
GDHNVICPLALFASSYARHHAEKANNGFGHLNNAGNSQEHAHLKKWVSPPRHKRDADHPT
GRGTSSDYKPVGSSPGRCPPTLLSRRLKKPPASHLSSPWFKPRLRCCTPSRKFHLKIPPA
CHRPLPREKPVKIWF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcccttttttcttcttctcccccttcctcctcttcctcatccccagctgc
tccacgcagagtgaggccgactttatcgttcagacaaaaagtgggcgtgttaggggtttc
caggtgacagtgccagaccaaagccgcccagtcgtcggctttttgggaataccgtttggg
gagccaccggtgggaaagaggcgttttcggcccgctgagccaaagcgcccttggcagggc
gtgtacaaagccgactcctaccctaatgcatgtttccagtttgttgacaaatcttatcct
ggctttccgggcatagagatgtggaatcccaacagggagatgagcgaggactgcctgtac
ctcaacatctgggtgccctcatcggtcaaaccacataatctgccagttatggtttggatc
tatgggggagggttctacagtggttcttcttcgttggacgtgtatgatggtcgctaccta
gccagtgtggagaatgttattgtggtatcgatgaactaccgcattggtgcgtttggcttc
cttgctctggatgggacatcggaggctcctgggaatgtgggtctgctggaccagaggatg
gccctgcagtgggtgcagaacaacattgcttcctttggaggagaccccagacaggtgacc
atctttggtgaaagtgctggtggtgcctccgtgggataccatctgttgtctccaggcagt
aggcctcttttcacccgggccattctccagagcggggtccccaactgtccctgggcctca
gtcacctatgctgaggctcggaggcgtgccacacagttggccaatgcggtcggctgtaat
ggaggcaatgacactgaactggtggactgtctgcggggtaaaactccacaggagcttatt
gatcaggaatggcaggtgctgccatggaccgccctcttccggttttcctttgtaccggtt
gtggatggggaggttcttcctgacgctcctgaggccatggtgaattcaggggactttaaa
gacacccagatccttctgggagtcaaccaggatgagggctcctactttctgctatacgga
gcacctggcttcagcaaggacaacgacagccttatttccagaaaagacttcctagcaggg
gtcaagatgggtgtaccacacgcaaacgacattggtctggaggcagtggtgctgcagtac
acggactggatggacgagaacaacggggagaaaaaccgcgatgccatggatgacatcgtg
ggcgaccacaatgtcatctgtccactggctctctttgcttcctcttatgccagacaccac
gctgaaaaggctaacaacggttttggacacttgaacaatgcaggaaattcacaagagcac
gcccacttgaagaaatgggtttctcccccgcgtcacaagcgcgacgcagatcaccctacc
ggcagagggacatccagtgactataaacctgttggatcctcacctggtcgctgtcctcct
acgctgctgtcacgccgcctcaagaaacctccagccagccacctctcctcgccttggttc
aagcctcgcctacgctgctgtaccccctcaaggaaattccacctcaagattcctccagcc
tgccaccgccctcttcctagggaaaaacctgtcaagatctggttctga

DBGET integrated database retrieval system