KEGG   Oryzias latipes (Japanese medaka): 101161887Help
Entry
101161887         CDS       T02443                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04620  Toll-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04810  Regulation of actin cytoskeleton
ola04910  Insulin signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04933  AGE-RAGE signaling pathway in diabetic complications
Module
ola_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101161887 (pik3cd)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101161887 (pik3cd)
   04370 VEGF signaling pathway
    101161887 (pik3cd)
   04068 FoxO signaling pathway
    101161887 (pik3cd)
   04070 Phosphatidylinositol signaling system
    101161887 (pik3cd)
   04150 mTOR signaling pathway
    101161887 (pik3cd)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101161887 (pik3cd)
  Cell growth and death
   04210 Apoptosis
    101161887 (pik3cd)
   04218 Cellular senescence
    101161887 (pik3cd)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101161887 (pik3cd)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101161887 (pik3cd)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101161887 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    101161887 (pik3cd)
  Endocrine system
   04910 Insulin signaling pathway
    101161887 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    101161887 (pik3cd)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101161887 (pik3cd)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101161887 (pik3cd)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101161887 (pik3cd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135 DUF4037
Motif
Other DBs
NCBI-GeneID: 101161887
NCBI-ProteinID: XP_004070711
Position
7
AA seq 1039 aa AA seqDB search
MHPGIYGMLEEWEDGDQEINMDFLLPTGIFLKFPVSRNDTIKHIKEMVWRNARSEALFSG
LGDPDGYVFTCINQTAEREELEEEFRRIRDVKPFMCVLRLVAREGNRQEKLTNTQITQLI
GKGLHEFETQKNHEVNEFRTKMRTFCEEKALERQYLPWQRWLEYSFPCDLEPCRTPSGFG
SVKMKSSKIFINVKFEASDESFMLQQDCHDLPVALMKSALKKKATVFRSLRQEPEDYILQ
VNGRWDFIYGKHPLCQFKYIFSCLRNGQNPQLTMVHHSTVSRFQEEQSRMCNQMFKSRSL
SRPPPLPLKRQNTSSLWSINEPFYIQLLQGSRVNADEGMKLVVQAGLFHGSELLCKVVTS
LDVTVCSEPLWDQRLEFDINVCDLPRMSRLCFALYAVIEKTKKPKSTKKKNKKADCPIAW
VNTMVFDYKDQLKTGEFLLSMWPSVPDDKSDLLNPMGTVEKNPNVDSAAGLLIRFPNIRP
HPLYYPSLEKIIDFEKNGDVACTHKEEHLKLKEIMDNKHYTEFFEDEKDLLWKLRTEIRE
HYPENLSKLLLVTKWNKREDVVQMVSLLKKWPDLPAIHALELLDYSFPDPAVRSFTVRCL
RKLSDDELLQYLIQLVQVLKYESYLDCDLTTFLLERALSNRRIGHFLFWHLRSEIHVASV
SLRFGLILEAYCRGNIHHIKILNKQNEALAKMRALSDFVKSGSQKMTVEDLKLCIRQETY
MEALSDLLSPLNPSIILTEICADKCRFMDSKMKPLWLMYKNPSTPGDMVGIIFKNGDDLR
QDMLTLQMIQLMENMWKKEGLDLRMIPYGCLSTGNKMGLIEVVKNSDTIANIQLNSSNSA
ATAAFNKDALLNWLKSKNPGDKLEQAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIRETG
QLFHIDFGHFLGNFKRKLGINRERVPFILTYDFVHVIQQGRTNNSEKFERFREYCEQAYK
ILCRNGMLFVNLFAMMKAAGLPELTCFKDIQYLKDSLALGKSEDEALKNFKVKFNEALRE
SWKTKVNWMMHSLAKDNRA
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgggatatatgggatgctggaggagtgggaggatggggaccaggagatcaac
atggacttcctgctgccaactgggatcttcctcaaattccctgtgtctcgcaatgacact
atcaaacacatcaaagagatggtttggcgaaatgccagaagcgaggctctgttcagtgga
ctgggtgacccggacgggtatgtgttcacctgcattaaccagacggccgagagggaggag
ctagaggaggagttccggcggataagggatgtgaagcctttcatgtgtgttctgaggctg
gtggcaagggagggtaacagacaagaaaaactcaccaacacccagatcacccagctcatt
ggcaaaggtctgcatgagtttgagacccagaagaaccacgaggtcaatgagtttcgaaca
aagatgaggacgttttgtgaagaaaaagctctggagaggcaatatttaccatggcaacga
tggcttgagtacagcttcccatgtgacctggagccatgccgcacgccgtctgggtttggg
agtgtgaagatgaaaagctcaaagattttcatcaatgtcaagtttgaggcttctgatgaa
agcttcatgttgcagcaggactgtcatgaccttcccgtggcgctgatgaagagcgctctg
aagaagaaggccaccgtctttcgctcgctgaggcaggagcctgaggactatatcctacag
gtcaacgggagatgggacttcatctatgggaaacacccactctgccagtttaaatacatc
ttctcgtgcttgagaaatggtcagaacccccagctcaccatggtgcaccactccaccgtc
agcaggttccaggaggagcagagcagaatgtgcaaccagatgtttaagagtcgctccctg
tccagacctcctcctctgcccctgaagaggcaaaatacctcctctttgtggtccattaat
gagcccttctacattcagctgctgcagggcagccgcgtcaatgcagacgaaggcatgaag
cttgtggtgcaggccggcctgttccacggcagcgagctgctctgcaaggtggtgacgagc
ttggatgtgacggtgtgctcggagccgctgtgggaccaaaggctggagtttgacataaat
gtgtgcgacctgccccgcatgagccgcttgtgcttcgcgctctacgctgtcattgagaaa
accaagaaacccaaaagcaccaaaaagaagaataaaaaagcggactgtccaatagcgtgg
gttaataccatggtgtttgactacaaggaccagttaaagacaggggaatttctcctatct
atgtggccatctgtacctgatgacaaaagcgatctgttgaacccgatggggacagtggag
aagaaccccaacgtggacagcgctgctggtcttctcattcggttccccaacattcgtccc
catcctctctattatccatcactcgaaaagataattgactttgagaagaatggagacgtg
gcgtgtacccataaggaagagcacctgaaacttaaagaaatcatggacaacaaacattac
acagagtttttcgaggatgagaaagatcttctgtggaagctccgcacagaaatccgcgag
cactatccggaaaatctgtccaagctgctcctcgtcactaaatggaacaaaagggaggat
gttgttcagatggtgagtttactgaagaaatggcctgaccttcctgccattcatgccctg
gaactcttggactacagttttcccgacccagctgtccgctccttcactgtccgctgcctg
aggaagctcagtgatgatgagctgctgcagtacctcatccagctggtccaggtcctgaag
tatgagtcctacctggactgtgacctcaccaccttcctgctagagagggccttatcgaat
aggagaataggacactttctcttctggcatcttaggtcagaaattcacgtggcatctgta
agtttgcgctttggccttattttggaagcatactgccggggaaacatccaccacatcaag
attttaaacaaacagaatgaagctctggccaaaatgagggccctgagcgactttgtcaag
tcaggctcccagaaaatgaccgtagaggacttgaagctgtgcatcagacaggaaacctac
atggaggccctgtcagacttgctgtcgccgctcaaccccagcatcatcctcacagagatc
tgtgcagacaagtgcagatttatggactcaaagatgaaacctctctggctgatgtacaag
aacccctcaaccccaggagacatggtgggcatcattttcaaaaacggcgatgatcttcgg
caagacatgttgactttgcagatgattcagctcatggagaatatgtggaagaaagaaggc
ctggatctcaggatgatcccatacggctgcttgtccacggggaacaaaatgggactcatt
gaagtcgtgaaaaactctgacaccattgcaaacattcagctcaacagcagtaacagtgca
gccacagccgccttcaacaaggatgccctgctcaattggcttaaatctaagaatcctggt
gacaagcttgaacaagcaatagaggagtttacattgtcctgtgctggctactgtgtagct
acatatgtgttgggaattggagatcgccacaatgacaacatcatgatcagagaaactgga
cagctgtttcacatcgactttggccatttcctgggcaacttcaagcgtaaacttgggatc
aaccgagagcgggttcctttcatcctgacatatgactttgtgcatgtgatccaacaagga
aggacgaacaacagtgagaagtttgagagatttagggagtactgtgagcaggcctacaag
atcttgtgcagaaatgggatgctgttcgtcaacctcttcgccatgatgaaggctgcaggg
ctgcctgagctcacctgcttcaaagacattcagtatctaaaggactccttagctttgggc
aaatccgaggatgaagcactgaagaacttcaaagtaaagtttaacgaagctttgcgagag
agctggaagacgaaggtcaactggatgatgcactccttagccaaagataacagagcataa

DBGET integrated database retrieval system