KEGG   Oryzias latipes (Japanese medaka): 101162036Help
Entry
101162036         CDS       T02443                                 

Gene name
bap1
Definition
(RefSeq) BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101162036 (bap1)
Peptidases [BR:ola01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101162036 (bap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 726 aa AA seqDB search
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQSPVYGFIFLFKWIEERRSRR
KVNTLVDETSVIDEEIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGSTLSRIKAFTK
GFSPESKGYAIGNAPELARAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRL
FELDGLKAYPIDHGPWGEEEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMK
YESKLEVLKKNRQTILEGLQKMIRLTQAEHLQEKKQPDASAAEDNIKKEAEASSGASSVD
ECKEASNSSAGSKTVGKPAAPSGGGSQQVSGSNPLVQRLPAFLDNHNYAKSPMQEEEDLA
AGVGRPRIPAPPQPPYSDDEDDDEDDEEDVTGSTSTASRFRRKASLRSRAGRVGSGMESQ
IALNVLAEKLKKEAQRKDALNTPLSVRTEGRTGGICITSASQPSPTPSNESTDTASEIGS
AFNSPLRSPARSQAATRPSSPVASHLSRVLFGEDEMLRLDSRHNRAVRELGPSVSVALLH
LQEDGVICALSSPGDLAAENTKQPCTSEKGKVAEKEATKEGGDGSSAEVKKEDEGKCGAD
VKPGKERLNAADSSSESKPPGDRYSPKELLALLKCVEADIANYEVYLKEEVEKRKKYKID
DQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRP
YKAKRQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggttggctggagctagagagcgatccaggactcttcactctgctggtagaa
gattttggggtcaaaggtgtgcaagttgaagaaatctatgatctccagagcaagtgtcaa
agtcccgtctatggcttcatcttcctcttcaagtggattgaagagcgccgatccaggagg
aaagtcaacactttggtggacgagacttcggtcatcgatgaggaaattgtaaatgacatg
ttttttgctcatcagctaatcccaaactcgtgtgccacccacgcactgctgagtgtcctt
ctcaactgcagtggagtggagctgggctccacactcagtcgcattaaggctttcactaaa
ggcttcagtccggaaagtaaaggttatgcaataggaaatgccccagagctcgccagagcc
cacaacagccacgccagaccggagccgaggcacttgccggagaagcagaatggcatcagt
gcggttcgtacaatggaagcgttccattttgtcagctacgtgcctatcaaagaccgcctc
tttgagctggatggactgaaggcttaccccattgaccacggaccctggggtgaagaggag
gagtggactgataaagctcgacgggtaattatggagaggattggactggccacagctggt
gagccgtaccatgacatccgcttcaacctgatggcagtggtgcctgaccggagaatgaag
tacgagtctaaattagaagttctaaagaaaaaccgacaaactattctggaaggtctgcag
aagatgatccggctcactcaggccgagcatctccaggagaagaagcagccagacgcctct
gctgccgaggacaacatcaagaaagaagcagaggccagctcaggcgcttcctcagtggat
gagtgcaaagaggcctctaactcttcagcgggctctaaaactgtgggtaaaccagcggct
ccctctggaggaggctcccagcaggtgagcggctccaaccccctcgttcaacggctgcca
gcattcctggacaatcacaactacgccaagtctccaatgcaggaggaagaggatcttgca
gctggtgtcggtcgcccccggatcccagctcctcctcagcctccgtactctgatgatgaa
gatgacgatgaagatgatgaagaggacgtgacaggttccactagcactgcgagcagattc
aggcggaaggccagtctgcggtccagagcaggtcgggtcggttccggaatggagagccag
atcgccctcaatgttttggccgagaaactgaagaaggaggctcagagaaaagatgctctg
aatacccccctgtctgtgcgcaccgaaggccgcacggggggcatctgcatcacatctgct
tcacagccttccccaacgcccagcaacgaaagcacagacaccgcgtctgagattggcagc
gccttcaactcgccgctgcgctccccggcacgctcccaggccgccacacgcccatccagt
ccagtagcatcccatttgtcgcgtgtgctgtttggagaggacgagatgctgaggctggac
tccagacacaatcgcgctgtgagagaactgggcccctctgtcagcgtagccctgctgcac
ctgcaggaggacggagtcatctgtgctctctcttcaccaggagatttggctgctgagaat
acaaagcagccttgcacttctgagaaaggaaaagttgctgaaaaagaggctacaaaggag
ggaggggatgggtcttctgcagaggtgaagaaagaggatgaggggaaatgtggagcagac
gtgaagcccggaaaagaaaggctcaacgccgcggattccagctcagagagcaaacctccc
ggggatcggtactcacccaaagagcttcttgcgttgctcaagtgtgtggaagccgacatc
gccaactatgaggtgtatctaaaggaggaagtggaaaagagaaagaaatataaaattgac
gatcagaggaggacccacaattacgacgagtttatctgcacatttatatcgatgctggcc
caagaaggtatgttagccagcctggtggagcaaaacatctctgtgcgccggcgtcaggga
gtgagtatcggccgcctgcacaaacagaggaagcccgatcgaaggaaacgctcccggcct
tacaaagccaaacgtcagtaa

DBGET integrated database retrieval system