KEGG   Oryzias latipes (Japanese medaka): 101162042Help
Entry
101162042         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 14A isoform X1
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
AGE-RAGE signaling pathway in diabetic complications
Salmonella infection
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101162042
   04370 VEGF signaling pathway
    101162042
   04068 FoxO signaling pathway
    101162042
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101162042
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101162042
   04621 NOD-like receptor signaling pathway
    101162042
   04622 RIG-I-like receptor signaling pathway
    101162042
  Endocrine system
   04912 GnRH signaling pathway
    101162042
   04914 Progesterone-mediated oocyte maturation
    101162042
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101162042
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101162042
  Infectious diseases
   05132 Salmonella infection
    101162042
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101162042
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101162042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
5
AA seq 361 aa AA seqDB search
MSQKERPTFYLQELNKTVWEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITA
SEALAHPYFAQYHDPDDEPEAEPYDQSFESRELEIEEWRSLIYDEVLSFEPPSLDGDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaggagagaccgactttctacctacaggagctcaacaaaaccgtgtgggag
gtcccggagcgataccagaacctctccccggtcggctccggcgcttacggttccgtgtgt
tcgtcgtatgacgtgaagacgtgcctgaaagtagcagtgaagaaattatccagacccttc
cagtccatcatccacgcaaagagaacgtacagagagctgcggctgctgaaacacatgaag
cacgaaaatgtgatcggcctcctagatgtgttcacaccggcaacaagcttagacgagttc
agcgacgtatacttggtgacacatctaatgggagcagacctcaacaacattgtgaagtgt
cagaagctgactgatgaccatgtgcagttccttatctaccagattctgagaggcttaaag
tacatccactcggcaggtatcgtccacagagacctgaagcccagtaatttggcagtgaac
gaagactgtgagcttaagatccttgactttggactggcgaggcacacagacgatgaaatg
acgggatacgtggccacccggtggtaccgagcccccgagatcatgcttaactggatgcac
tacaacatgacagtggatatttggtcggtgggatgcatcatggcggaactacttacagga
cgaacacttttccctggcacggaccatataaaccagctgcagcagataatgcgcctgacg
ggaacgcccccggcctccctcataagcaggatgccgagccacgaggcaaggaactacatc
aactcacttccccacatgcccaaaaggaactttgctgatgtgttcattggtgcaaatccc
ttggcggtggatttgctcgaaaagatgctggtgctggacacggacaaacgcatcacggcg
tcggaagcgctggcccatccttactttgctcagtaccacgacccagacgacgagcctgaa
gccgagccgtatgatcagagcttcgaaagccgggagctggaaatcgaggagtggaggagt
ctaatctacgacgaggtcctgagcttcgagccgccatctttagatggagacgagatggag
tcgtga

DBGET integrated database retrieval system