KEGG   Oryzias latipes (Japanese medaka): 101162042Help
Entry
101162042         CDS       T02443                                 

Definition
mitogen-activated protein kinase 14A-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Salmonella infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ola04010]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ola04370]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ola04068]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:ola04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:ola04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:ola04622]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ola04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:ola04914]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:ola04261]
Human Diseases; Infectious diseases; Salmonella infection [PATH:ola05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 361 aa AA seqDB search
MSQKERPTFYLQELNKTVWEVPERYQNLSPVGSGAYGSVCSSYDVKTCLKVAVKKLSRPF
QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLDEFSDVYLVTHLMGADLNNIVKC
QKLTDDHVQFLIYQILRGLKYIHSAGIVHRDLKPSNLAVNEDCELKILDFGLARHTDDEM
TGYVATRWYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLT
GTPPASLISRMPSHEARNYINSLPHMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITA
SEALAHPYFAQYHDPDDEPEAEPYDQSFESRELEIEEWRSLIYDEVLSFEPPSLDGDEME
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagaaggagagaccgactttctacctacaggagctcaacaaaaccgtgtgggag
gtcccggagcgataccagaacctctccccggtcggctccggcgcttacggttccgtgtgt
tcgtcgtatgacgtgaagacgtgcctgaaagtagcagtgaagaaattatccagacccttc
cagtccatcatccacgcaaagagaacgtacagagagctgcggctgctgaaacacatgaag
cacgaaaatgtgatcggcctcctagatgtgttcacaccggcaacaagcttagacgagttc
agcgacgtatacttggtgacacatctaatgggagcagacctcaacaacattgtgaagtgt
cagaagctgactgatgaccatgtgcagttccttatctaccagattctgagaggcttaaag
tacatccactcggcaggtatcgtccacagagacctgaagcccagtaatttggcagtgaac
gaagactgtgagcttaagatccttgactttggactggcgaggcacacagacgatgaaatg
acgggatacgtggccacccggtggtaccgagcccccgagatcatgcttaactggatgcac
tacaacatgacagtggatatttggtcggtgggatgcatcatggcggaactacttacagga
cgaacacttttccctggcacggaccatataaaccagctgcagcagataatgcgcctgacg
ggaacgcccccggcctccctcataagcaggatgccgagccacgaggcaaggaactacatc
aactcacttccccacatgcccaaaaggaactttgctgatgtgttcattggtgcaaatccc
ttggcggtggatttgctcgaaaagatgctggtgctggacacggacaaacgcatcacggcg
tcggaagcgctggcccatccttactttgctcagtaccacgacccagacgacgagcctgaa
gccgagccgtatgatcagagcttcgaaagccgggagctggaaatcgaggagtggaggagt
ctaatctacgacgaggtcctgagcttcgagccgccatctttagatggagacgagatggag
tcgtga

DBGET integrated database retrieval system