KEGG   Oryzias latipes (Japanese medaka): 101162387Help
Entry
101162387         CDS       T02443                                 

Gene name
nlk
Definition
(RefSeq) serine/threonine-protein kinase NLK
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04310  Wnt signaling pathway
ola04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101162387 (nlk)
   04310 Wnt signaling pathway
    101162387 (nlk)
   04068 FoxO signaling pathway
    101162387 (nlk)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    101162387 (nlk)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101162387 (nlk)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101162387 (nlk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 101162387
NCBI-ProteinID: XP_023817106
Position
13
AA seq 527 aa AA seqDB search
MALCGTTAANAPKMMAAYPGGSSAVAAAHHHHQQLQHLPPPHMHHHHHHHHHAGQHHLQH
PGSAAAVHTVQQHTTAAAAAAVMLNPGQQQPYFPSPAPGQAPGPAAAAAPAQVQAAAGVK
AHHQHQQNSHHLQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLSFFKHENVLSALDVLQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
AKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEESDESRHMTQE
VVTQYYRAPEILMGSRHYSNSIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SMEAMRTACEGARAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCYTTSSGRVYTSDFEPVTNAKFDDGFEKNLTSVRQVKEI
IHQFVLEQQKGSRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgtggcaccaccgccgccaatgctccaaaaatgatggcagcttaccccggc
ggctcctcggcagtggctgctgcccatcaccaccaccagcagctccagcacctcccgccg
ccccacatgcaccaccaccaccaccaccaccaccacgcgggccagcaccacctgcagcac
ccaggctccgctgcggccgtgcacacggtccagcagcacacgaccgcagcggcggcggcg
gcggtgatgctcaaccccggccagcagcagccgtacttcccctctcccgcccccggacaa
gcccctgggccggcagccgccgccgctcctgcccaggttcaggctgctgctggtgtcaaa
gcccaccaccagcaccagcagaactctcatcacctccaacagcagctggacattgaaccg
gaccggcccattggctatggagcatttggggttgtctggtctgtgaccgaccccagagac
ggaaagcgagtcgccctgaaaaagatgcccaatgtcttccaaaacctggtttcctgcaag
agggtgtttcgagagctgaagatgctgagtttctttaagcatgagaatgtgctctctgct
ctggacgtacttcaacctccacacatcgactactttgaagaaatctacgtcgtgactgaa
cttatgcaaagcgacctccataagatcatcgtatctccacagcctctgagctcagaccac
gccaaagttttcctctaccagattctgcgaggactgaaataccttcattctgctggaatt
ctgcaccgagacatcaaacctggcaacctgctggtcaacagcaactgtgtgctgaagatc
tgtgactttggcctggcccgcgttgaggagtcagacgagtcccggcacatgactcaggaa
gtggtgacccagtactacagagcaccggagatcctcatggggagccgccactactccaac
tccattgacatctggtctgtgggttgcatctttgcagagctgctgggcagacgcatcctc
ttccaagctcagagccccattcagcagctggatctgatcactgacctgctggggacgcca
tccatggaggccatgaggacggcatgtgagggagctcgcgcccacattctcagaggaccc
cacaaacagccatcgcttcctgtcctgtacacactgtcgagccaagcgacccacgaggcc
gtgcacctcctctgcaggatgctggtctttgatccctccaaacggatttcagcaaaggac
gccttggcccacccgtacctggatgagggccgcttgcgctaccacacctgcatgtgcaaa
tgctgctacaccacctcctccggccgtgtttacaccagcgactttgagccggtcaccaac
gccaagtttgacgacggcttcgagaagaacctgacctccgtcagacaggtcaaagagatc
atccaccagtttgtgttggagcagcagaagggcagtcgagtgccgctgtgcatcaacccc
cagtctgctgctttcaaaagcttcatcagctccacggtggcgcagccctcggagatgcct
ccatcgccgctggtgtgggagtga

DBGET integrated database retrieval system