KEGG   Oryzias latipes (Japanese medaka): 101162387Help
Entry
101162387         CDS       T02443                                 

Definition
(RefSeq) serine/threonine-protein kinase NLK-like
  KO
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101162387
   04310 Wnt signaling pathway
    101162387
   04068 FoxO signaling pathway
    101162387
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    101162387
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101162387
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101162387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
13
AA seq 452 aa AA seqDB search
MALCGTTAANAPKMMAAYPGGSSAVAAAHHHHQQLQHLPPAAGVKAHHQHQQNSHHLQQQ
LDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVFRELKMLSFFKHE
NVLSALDVLQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHAKVFLYQILRGLKYL
HSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEESDESRHMTQEVVTQYYRAPEILMGS
RHYSNSIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSMEAMRTACEGARAH
ILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYH
TCMCKCCYTTSSGRVYTSDFEPVTNAKFDDGFEKNLTSVRQVKEIIHQFVLEQQKGSRVP
LCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgtggcaccaccgccgccaatgctccaaaaatgatggcagcttaccccggc
ggctcctcggcagtggctgctgcccatcaccaccaccagcagctccagcacctcccgcct
gctgctggtgtcaaagcccaccaccagcaccagcagaactctcatcacctccaacagcag
ctggacattgaaccggaccggcccattggctatggagcatttggggttgtctggtctgtg
accgaccccagagacggaaagcgagtcgccctgaaaaagatgcccaatgtcttccaaaac
ctggtttcctgcaagagggtgtttcgagagctgaagatgctgagtttctttaagcatgag
aatgtgctctctgctctggacgtacttcaacctccacacatcgactactttgaagaaatc
tacgtcgtgactgaacttatgcaaagcgacctccataagatcatcgtatctccacagcct
ctgagctcagaccacgccaaagttttcctctaccagattctgcgaggactgaaatacctt
cattctgctggaattctgcaccgagacatcaaacctggcaacctgctggtcaacagcaac
tgtgtgctgaagatctgtgactttggcctggcccgcgttgaggagtcagacgagtcccgg
cacatgactcaggaagtggtgacccagtactacagagcaccggagatcctcatggggagc
cgccactactccaactccattgacatctggtctgtgggttgcatctttgcagagctgctg
ggcagacgcatcctcttccaagctcagagccccattcagcagctggatctgatcactgac
ctgctggggacgccatccatggaggccatgaggacggcatgtgagggagctcgcgcccac
attctcagaggaccccacaaacagccatcgcttcctgtcctgtacacactgtcgagccaa
gcgacccacgaggccgtgcacctcctctgcaggatgctggtctttgatccctccaaacgg
atttcagcaaaggacgccttggcccacccgtacctggatgagggccgcttgcgctaccac
acctgcatgtgcaaatgctgctacaccacctcctccggccgtgtttacaccagcgacttt
gagccggtcaccaacgccaagtttgacgacggcttcgagaagaacctgacctccgtcaga
caggtcaaagagatcatccaccagtttgtgttggagcagcagaagggcagtcgagtgccg
ctgtgcatcaacccccagtctgctgctttcaaaagcttcatcagctccacggtggcgcag
ccctcggagatgcctccatcgccgctggtgtgggagtga

DBGET integrated database retrieval system