KEGG   Oryzias latipes (Japanese medaka): 101162786Help
Entry
101162786         CDS       T02443                                 

Definition
histone-lysine N-methyltransferase MLL3-like
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101162786
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101162786
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101162786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 4802 aa AA seqDB search
MSSEDKSVEPSDQLPSPLPSSVGATSTGSPVHTDKRPRGRPRKDAVAILAQTPPPSTSKN
KKKGRTRGKVAVEEEDSMDGTEITESTDPPDTETQTQQAETMEVLTADLPDEDKPFSPLA
FSPSVESSDGPTVPPSGGIKSSERLCAFCYCGGHSLLGQGDLKVFNTTFQDEKFLRCRGE
GGSTNDNGDGDTTTQPQLAEDIASGQKEKNGAVSCKAEPDLASRFWDELSYVGLPKDLEV
QSLFESGKCWAHESCALWSDGVCKSEGQSLLNVDRAIDSGSTKHCAYCKRLGASIKCCAE
GCAQLYHYPCAGAAGTFQDIRSLSLLCPDHIEVAIHKFVDDVNCVLCDSPGDLLDQLFCT
SCGLHYHGMCLDMAVTPLRRAGWQCPECKVCQTCKNHGDDTKMLVCDMCDKGYHTFCLQP
AMESLPTNGWRCKNCRVCIQCGTRTSGHWHHNSLLCENCFQNQDPALCCSMCSCILDPEH
HKDLLFCQTCKRWLHLECERQNSGQTEINPREDYVCFNCRSPAAEQALLTEDMDLGPELR
LQPASMHTDSETGLQLAEKHTDPETGNQLPPEMHNDPKPELVTVSLHSDPKPVQATVQKE
ELPVTDQKPESKPAVGIQLLSEESPVASSNQSQEPLPVQQPAEATEAQDTLLQIKPAHTE
ACPFEGMANHSTKDFKAIISPTKEQSTTPVTYVDQPMEVTLLPQPSSVNLTGASFLETAP
TELRKRHEIPFHITLPEAAKPSSSRTSADMDTTLENKPNLSFTSLSLEEKPIKSSVERLV
EMVSSSHSSPLTRMAPLKEAPQTHILPSLDDGSGVIPPTALVPFTPKIGMGKPAITKRKF
SPGRPRVKQGAWSPHSSVSSPLSWSSDQPEGWDPKTRQPSYSPGWSIRVGRGSGFPGRRR
PRGAGLSGRAGRGRARGKNGVSSSINPGLTTFEMQYPVKEEEENAMHNTVVIFSSNDSFT
LKQDMCVVCGSFGLGAEGRLLACAQCGQCYHPFCVGIKINKVVLSKGWRCLECTVCEACG
QATDPGRLLLCDDCDISYHTYCLDPPLQNVPKDSWKCKWCVSCTQCGATTPGLRCEWQSN
YTQCAPCASLSTCPICLVNYSEGTVIVQCRQCDRWFHASCQGLHSEDDLEKAAENSFDCT
ICQTLKTTKVVTKTRDSNAPLVLTPYVTKARELDLSRTYTQDGVCLTESGLCQLQSLSAA
ASRRRKTKPKLKLKIINQNSVSVLQPPMDSLSELSRDEDMEDNREAELLDCEAKSDSSLE
REPMEDDSKGVDGGKKRKRKPYRPGIGGFMVRQRSRPGQGPGKAKRSYCRKDSSGSMSEN
LIGKDEGWAELHPDTPVDEVAPGPEVPEKIKKRYRKKKTKLEEAFPAYLQEAFFGKDLLD
KSKQSRQHGGESGLLEDGQNQVERRRTNTSVLDSSSVLNFSATSIPTRPETPDEPLVDLA
DVLNSDADILGMLGKSSSESAGLDIGPLTDSSTVGSQTGRRTPRTIADEPLDGILSPELD
KMVTDGTILSKLNKIPELEGKDVEDLFTAVLSPSTSQPLTTQMPHPQIPGALPPTACSSM
SHPNTAFPRMPMINGMMGPNQRFPANPGTGPRFPENVSSLNRMPFSENPRDRKFNQMPRE
AVGPWPPSAHGSAPALPGSLPEGETEAMSNAQRSTLKWEKEETLGELATVAPVLYTNINF
PNLKEEYPDWSTRVKQIAKLWRKASSQDRAPYVQKARDNRAALRINKVQMSNETVKRHHP
QQQPPEVFDPNIPLDTELLFKDPLKPKESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQV
KNEQLQQQQQQQQPSSQSDGDGSNQSPASQPSNESMSPMQQFNSKENFVRPHLQGTPSSA
PLEDVFIRPQPPPPSGPSSQPQSPQVFSPGSSGSRPSSPWDPYAKMVGTPRPPTLGPNAC
RRIPVESSKSPTPLIEQQDKGRPSPAHESFGSPTSASSDPYAKPPDTPRPSGEVDLFLKP
MGPPRNIQSAHGRPPMGSPGRDPYSRPMIRNDAYQRMTQNRMILSDPYSRPLIAPIPGSN
ESGSVPLFKTPMPPPQTQDLFNRPGPHSNDRFLQNQQSDPYAQPPHTPRPLGNDGFTNPS
RMGQHHLQGHSFHQPGPMNQTSRNPYAHAPSTPRPDHFTYDHYPQPPGPNKQGSDSFSQP
TVNQRAINEHGTQPRPFFEPYARPPGTPRPHDNYVQPSNAFSQSSDPYLQAPGTPRPSMM
NQFSHQSLHGQRTSPSHPVDPYGQSQSAPRNSVGERFSKSPGSQRGMAEPFPSTCVPLRA
GIGEAFPQPGAPRPMLNDPYAQPPGTPRPGPDGLNRPVLKIGPLASQDPFSSPQGRLQEH
FSHSDSHAPKHSNVPEDGFSQSPSRRPNQTPSHDPFDQAPMTPHSQSAENIEAKDQAAVS
ISGTGPQDPVQLFNNPQVSGTSADAQGLAAVETEERLKQRQKIRELIKQHQQKRQERSLQ
EPASMAPGTPRPWPQEGPSQQGEVFNRPPPPYPGQVPIRGPTRFPGAFQGDRVPFHNEGQ
LPCAPNPGDSNLRHQGPRFAFPAGLLGPHGAQGFFPRGQHPMQDVPPQIRQSMSAEMTRG
MGGNPMGLPQHFPPHNMPMQQHNIMGQHFIELRHRTVENRPRAPFPLGAMQGNNLDPNVQ
GQRSAGFPGAHDSRFHLNHGLKMLDPNQTGHLQPSASMENLHHQTQSSGINPMKQSPLMR
SMSQPASNEAHNFAPSMMFPAASAGPIENVSVNNSEAVEEKLDTDDSAVKDLEDVEVKDL
VDADLENLNLDPEDSKDLDLETNDLHLDDFLTSGKFDIIAYTDPDSDDIKKDMFNEELDL
GDPIDDAAESTNTNKIISTESGKSIATVAKSECASKQSTEEPKPEVSGNRDSDSLPPDQV
VKSEVKDCQRPTKVVHQQASENATHQQGVLSDSTPVLSSLLIKQQPEEQSLNTISASVSQ
GANLMVQQNQVTDTRQTSEHALSQTIPDTTVGEVSVTGFGVEQQMGLSPGVDQSGLSQTQ
QGGGQLGQQQRPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSSDSFFPKIDFETI
TDPIMKAKMVAIKGINKVMVQNNMGMTPMVMNRYPPGPGPPCPESTPLPPQVLGPDGKLT
QVTRPNPPTFGPGFVNNPQRAQYEEWLQETQQLLQMQQKFLEEKIGAHRKSKKALSAKQR
TAKKAGREFPEEDAEQLKHVTEQQGVVQKHLEQIRKQQKEHAELIEEYRVKQQQNNMTPI
MSGMHPLPGSAGMVPAGPPMVQPPINPMMQMPLRSGQPNAPPRMPNPQPGWHPGAPMPMS
GPGMPPLMPPQVPVANPPQPLQMPMAQMPMDPQAPHAPPGGAKPLQAGGVKFDDNNPFSE
GFQERERRERLREQQERQRVQLMQEVERQRALKHRMEMEQQGMMGPDGNMAPLAQMPFFN
SELPQDFMQPQRPSMPQSHQLGPMFPQQQGMQHGISSPPGTFIQGDRRGMMGNGMMAADV
GPDNVPLQGLGFPHGHPRPRQFSGPGLMPAEGPPFDGDTATPLPSNFPGSGQSLIQLYSN
IIPDEKGKKKRNRKKKKEDDADSVKTPSTPHSDLTAPLTPCVSDTSSTPTRNTHLFGEQD
LSRSPLLGSSTPSHTELEKQLSAAQSGPHGLPSETSRTQVQDHDRILSNIKLEKTETTEC
HGQREGSICSDMSSVKEEGNKGGVSPFPAEQSPNKGESSNELLKHLLKNKSTPPPALSHQ
RSEESLRSEEGETPDCKSFLRQSSMDSSGAYSDGTSDFPGPQLPEQEKKKGRNKRPPKGG
EKPASRYKKRKKDRDERQLMHSGSDTVITQIKQQSNLSNPPTPPASLPPTPPPVSRQKMI
NGFATTEELASKAAAMVSKGLVPKPLHVPFRPEEDLLARAIAQGPKTVDVPASLPTPPHN
NQEELRGQEACKDRDTPDSFVPSSSPESVVGMEISRYPDLRLVKEEPLSPCLSPAFPLLP
APDGKGSEIKLQDIKTEPSFMFFGSPLGPVSSDSKQGLVSVAITLRPAAAENITGVVAAI
SDLLCVKIPSSYEVSSTPDRAPLSMLNAQRMGPLGMEARHPMLFHGHGDGGGLQGRHGQM
IRAGGPQGVMQQQGHQFRFYQNNQVVVLGSGVQKAIRDLPDHMKEPQMGLNSEEDLVFCS
HSCFVLYCSSSLSQSRPMAAETKESMSLLPSSDQSENLCKAHHQYNNNMSSLDVHCLAKL
QPKHSPPSTPPIPFPAADEAPKSEIKSDALKVTVKLKARPRSHDGWHQGKRQKGLRWRKW
TVQVVVPRGNSHLPDEDKIDELLKKLGASLRPPASLKDQRRCCFCHQFGDGITDGPARLL
NLDLDVWVHLNCALWSTEVYETQAGALINVELALRRGQTIRCAYCQQIGATSGCHRPRCT
NIYHFTCALQAQCTFFKDKTMLCHAHRPRGTGGQALEHELRCFAVFRRVYVQRDEMRQIA
TAVQQPELGFTFRVGSLVLHAIGQLTPLQMASFHSSTAIFPVGYEACRVYWSMRHGNRRC
RYVCSVEDNDGLPEFTIRVIERGYPDLLLTDASPKGVWDKVLGPVAEKRSESGTLQLFPV
YLKGEDLFGLTVPAVTKITESLPGVESCDRYSFRYGRNPRLVLPLVFNPAGCARAQPRTS
SPYTSLVIRPQPQAASSSSARSNQNVAQGEGGVPHSKTPVVHPRSSQYRWMKSEWRANVY
LGRSQIQGLGLFAARDIEKQSMVIEYNGTILRNEVAIRKEKVYRSQNRAVFMFRIDSEHV
VDATRTGGLARYINHSCAPNCVAEVVTFERGYKIIISCVRRVEKGEEGYQNDVVLHNAHT
CL
NT seq 14409 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagaggataagtctgtggaaccctctgatcagcttccctcaccgctgcctagc
agtgtaggggccacatccacaggaagccctgtccacacagacaagagaccccgtggcagg
ccacgcaaggatgctgttgccatcctagcccagacaccacccccatccacatctaagaac
aaaaagaaaggtcgcaccagagggaaagttgctgtagaagaagaagacagcatggatggg
acagagataacagagtccactgaccctccagatacagaaacacaaacccaacaggcagag
actatggaagttctgaccgctgatttgccagatgaagacaaaccgttttcccctctggcc
ttcagtccgtcagttgaaagctcagatggaccaactgtcccgccaagtggaggaatcaaa
agcagtgagcgactctgtgccttttgttactgcggtggccatagccttctgggtcaggga
gatctgaaagtattcaacaccacatttcaagatgaaaaattcctccgctgtagaggtgaa
ggaggctcaacaaacgataatggtgatggtgacacaaccactcagccacaattggccgaa
gacatcgcctcaggacagaaggaaaagaacggggctgtgagctgcaaagcagaaccggac
ctcgccagccgattctgggatgagctctcttatgttggccttccaaaagatcttgaagtc
cagtctctctttgagtcagggaaatgttgggcacatgagagttgtgccttgtggtctgac
ggtgtttgtaagagtgagggacaatctctgcttaatgtggacagagccattgactcaggg
agcacaaagcactgtgcatactgtaagcgccttggagcatccattaagtgctgtgctgaa
ggatgtgctcaactctaccattacccctgtgcgggggcagccgggacttttcaggatatt
aggagtttatcgctcctctgcccagatcacattgaagtggcaattcataaatttgtagat
gatgtaaattgcgtgctgtgtgatagtccgggggacctactggaccagctcttctgcaca
agttgtggtctgcattaccatgggatgtgcctggacatggccgttactcctctaagaagg
gcaggttggcaatgccctgagtgcaaagtctgccagacatgcaagaaccatggagatgac
actaaaatgctggtttgtgatatgtgtgacaaaggctaccacaccttttgtcttcagccg
gccatggaatctcttcccaccaatggatggagatgtaagaactgcagagtatgcatccag
tgtggaacacgaaccagtggacattggcaccacaacagcctactgtgtgagaattgtttc
caaaaccaggatcctgctctgtgctgctcaatgtgttcttgcatcctggaccctgagcat
cacaaagacttactgttttgtcagacttgtaagagatggttacacctggagtgtgagcgt
cagaacagcggccaaacagaaatcaacccaagagaggactatgtttgttttaactgcagg
tctcctgctgcagagcaggctctactgacagaggatatggaccttggcccagagctcagg
cttcagccagcctccatgcacacagactctgagactggcctacagctggctgaaaagcac
acagaccccgaaactggcaaccagctgccccctgaaatgcacaatgaccccaaaccggaa
ttagttactgtttcattgcattctgatccaaagcctgttcaggctaccgtccagaaggag
gagctacccgtgacagaccagaagcctgaatcaaaaccagcagtcggaatccagctcttg
tcagaagaaagtcctgtagcgtcatcaaatcagagccaggagcctcttccagtccaacag
cctgcggaggccacagaggcacaggacacattgttgcaaatcaaaccagcacatacagaa
gcctgcccttttgagggcatggctaaccatagcacaaaggattttaaggccattatttca
cccaccaaagagcagagtactacgccagttacttatgtggaccaaccaatggaagtcaca
ctactaccccagccttcaagtgtgaatctaaccggggcttctttcttggaaactgctcca
actgaactgaggaaaagacatgagattccgtttcatataaccctcccagaggctgctaag
ccctcatcctcaaggacttcagcagacatggacactacactggaaaacaaaccaaatttg
tcatttaccagcttgtcattggaggagaagccaatcaagtcgtctgtagaaagattagtt
gaaatggtttcttcttcccactcctcccctttgactcgaatggccccactcaaagaagcc
ccccagacccacattctgccctcactggatgacggcagcggtgtgatacctccaacagcc
cttgttccgtttaccccaaaaattggaatgggaaagccagccattacaaagaggaagttt
tctcctggaaggccacgagtcaaacagggtgcatggagccctcatagcagtgtgagctca
cccttgtcctggtcatcagaccagccagagggttgggacccaaagaccaggcagccttca
tacagccccgggtggagcatcagagtgggtcgaggctcaggcttccctgggaggaggcgt
ccaagaggagctggtctgtcgggtcgagctgggcgcggcagagccagaggaaagaatgga
gtcagctccagcatcaaccctgggctgacaacatttgaaatgcagtacccggtcaaggaa
gaggaggaaaatgcaatgcataatacagttgtcattttttccagcaatgacagttttact
ctgaaacaggacatgtgtgtggtgtgtgggagttttggcctcggtgcagagggtcgtctt
ctggcctgcgctcagtgtggccagtgctatcatccgttctgtgttggcataaagatcaat
aaggtggtgctaagtaaaggctggcgttgtttggagtgtactgtgtgcgaagcttgtggc
caagccacagatccgggccggttactgctgtgtgatgactgtgacatcagctatcacacc
tactgcctggaccctccactgcagaatgttcccaaggacagctggaagtgcaagtggtgt
gtgtcatgcactcagtgtggtgccaccacccctggccttaggtgcgagtggcagagtaat
tacacccagtgtgctccctgtgccagcctttccacatgtccaatctgcctggttaactac
agcgaaggcaccgttattgttcagtgccgccagtgtgacagatggtttcacgcctcctgt
caggggttacactcggaggatgatctagaaaaagctgcagaaaacagcttcgactgcacc
atatgccaaactttaaagaccactaaagttgtgactaagaccagagacagcaatgcgcca
cttgtcttgacaccatatgtaacaaaggctagagaacttgatttatcgaggacatacacc
caggatggtgtttgtttaacagagtcagggctctgtcagcttcagagcttatctgctgct
gcttcaagacggcggaaaaccaagcccaagttgaagctgaaaatcattaaccagaacagt
gtgtctgtgcttcagcctcccatggactcgctctcagaactctcacgggatgaagatatg
gaggacaacagagaggcggagctcctcgattgtgaagcaaagtctgattcgagtcttgag
cgagagccaatggaggatgactccaagggggtcgacggcggcaagaagaggaagaggaaa
ccgtaccggccgggcattggtgggttcatggttcgccagaggagccgtccaggccaagga
ccgggaaaagccaagcgctcttattgcaggaaggactcgtctggctccatgtcagagaat
cttatcggaaaagatgaaggttgggcggagctgcatccagatactcctgtagatgaagtt
gcacctggaccagaggttccagaaaagataaagaaacgctaccggaagaaaaagaccaag
ctagaggaggctttccccgcctaccttcaggaggctttctttggaaaggatcttttggac
aaaagcaagcagagtagacagcatggaggtgaatcgggcttactagaagatgggcaaaac
caagtggagcgaagacgcaccaataccagcgtcctggactcttcatcggtgctcaacttc
tcggcaacgtctattcctaccagaccagagacgcccgatgaacccttagttgatctagct
gatgttctgaactctgatgcagacatcttgggaatgctcggaaagtcaagcagtgaatct
gctggtttggacattgggcccctgacggacagctccacagtggggtctcagactggtcga
agaacacctcgaacgatcgcagacgagcctttagacggcattctcagcccagagcttgat
aagatggtgactgatggaacaattctcagtaaactcaataaaattccagagttggagggc
aaggatgtggaagatctctttacggcagttctcagcccaagtacaagccaaccactaacc
acacagatgccccacccccaaattccaggtgctctccctcccacagcttgcagtagcatg
tcccatcccaacacagcctttccaaggatgcctatgatcaatggcatgatgggaccaaat
caacgtttccctgcaaaccctggaacagggccccgcttcccagaaaatgtttcctcgctt
aaccgaatgcctttctctgaaaacccaagagatagaaaatttaatcagatgcctagagag
gctgttggtccatggccgccctctgcacacggttctgctcctgcactccccggatctttg
cctgaaggagaaactgaagccatgtcaaatgctcaaaggagtacactaaagtgggagaag
gaagaaacacttggagaactagccaccgtggcacctgtcctgtatacaaacatcaacttc
cccaacctcaaagaagaatacccagattggtcaacaagagtaaagcaaattgctaaactg
tggaggaaagctagttcacaagacagggccccatatgtgcaaaaggcaagagataaccga
gcagccctgcgcatcaacaaagtccagatgtcgaatgagacagtgaagaggcaccatcca
cagcaacagcctcctgaggtgtttgatcccaacataccactagacacagaactcctgttt
aaagaccctttgaaaccaaaagagtcagagcatgaacaagagtggaagtttagacagcaa
atgagacagaaaagcaagcaacaagccaaaattgaagccacacagaaactggaacaagtg
aagaatgagcaactccaacagcagcagcaacaacagcagccaagcagccaatcagatgga
gatggcagtaaccagagcccagcctcccagcctagcaatgaaagcatgtcccctatgcag
cagtttaattctaaagaaaattttgtcagaccacacctgcaagggacgccttcctcagct
cctttagaggatgtgtttatacggccacaacctcctcctccatctgggccttcgtcccag
cctcagtctcctcaagtattttcaccaggttcttctggatccagaccctcctcaccatgg
gacccatatgccaaaatggttggtacccctagaccaccaactctcggaccaaatgcctgt
cgcaggataccggtggaatctagcaagtctccaacccccctgattgaacagcaggacaaa
ggaagaccctctccagcacatgaatcttttggttctcctacatcagcaagcagtgacccc
tatgccaaaccccctgacactccaagaccatctggagaagtcgacctttttctgaaacca
atgggtccacccagaaacattcagtctgctcatggacgacccccaatgggctctcctggc
agagacccatattcaaggcccatgatcagaaacgacgcataccagcgtatgacccagaac
cgaatgattttgtccgatccctattcaaggcctttaatagcgccaatacctgggagtaac
gagtcaggctcagttcctctgtttaaaacaccaatgccgcctcctcaaactcaagatctg
tttaatcgaccaggtcctcattccaatgacagatttttacagaatcagcagagtgaccct
tacgcacaacctccacatacccccagaccacttggtaatgatggatttaccaatccatct
agaatgggccagcatcacctacagggacattcatttcatcagccaggcccaatgaatcag
acatctagaaacccttacgcacatgctccatccacaccaaggccagaccacttcacatat
gaccactatcctcaaccccctggtcctaacaagcaaggcagtgattccttttcacagcct
acagttaatcaacgggccatcaatgaacatggaactcaaccccggccattttttgaacct
tatgcccgaccccctggcactccacgtccacatgacaactatgttcagccatcaaatgca
tttagtcagtcttcagacccctatttacaggctcccggtactcctcgtccaagtatgatg
aaccagttctctcatcagtctctccatgggcagaggacatctccctcccatccagtcgac
ccttatggacagtcacaaagcgctccaagaaattctgttggagaaaggttctcaaagtcc
ccaggtagccagagggggatggcagaaccatttcctagtacttgtgttccgctaagagca
ggcattggtgaggcattccctcaaccaggggccccaagaccaatgcttaatgacccctat
gcccaacctcccgggactccaagacctggtcctgatggcctgaacagacctgtactcaag
attggaccattggcaagtcaggatcctttctcctcgccccaaggcagactccaagagcat
ttttctcattcagactcgcatgcaccaaaacattcaaatgtcccagaagatggatttagt
cagtctccatccagaaggcccaatcagacacctagccatgacccttttgaccaagcccca
atgacccctcattcacagtcagctgaaaacattgaagcaaaggatcaagcagctgtaagt
atcagtggaaccggccctcaagaccctgtccaattgtttaacaaccctcaagtctccggt
acttcagctgacgctcaggggcttgctgctgttgagactgaggagagactcaaacagaga
cagaaaatcagggaactcatcaaacagcaccaacagaagagacaagaaaggagccttcag
gagccggccagcatggctccaggaacaccaagaccatggccccaggagggccccagtcaa
cagggtgaagtgttcaaccgaccacctccaccatatcctggacaagtacctataagagga
cctacaagatttcctggagcttttcaaggagatcgtgttcctttccataatgaaggacaa
cttccgtgtgccccaaatcctggagattctaatttgaggcatcaaggaccaaggtttgcg
tttcctgctggacttttaggaccccatggggcacaagggttctttccaagagggcagcac
ccaatgcaagatgtacctcctcaaattagacagtccatgtcagcagaaatgacgagaggt
atgggaggcaatccaatgggacttccccagcactttccaccgcataatatgccaatgcag
cagcacaacatcatggggcagcatttcatcgagctgcgacacagaacagtagaaaacaga
ccacgtgctccttttccactgggcgccatgcaaggaaacaatttggatcccaacgtgcag
ggtcaaaggtcagctgggtttcctggagcgcacgattcaagatttcatttaaatcacgga
cttaaaatgttagatcccaaccagactggtcacttgcagccttctgccagcatggaaaat
cttcatcatcaaacccaatcatcaggaatcaacccaatgaaacaatctccactgatgaga
tctatgagccaacccgcctcaaacgaggcacataactttgcaccatccatgatgttccct
gcagcctctgctgggccgattgagaatgtttccgttaacaacagtgaagctgttgaggag
aaacttgatacagacgattcagcagtcaaagatcttgaggatgttgaggtgaaagatctt
gtagatgctgacttggaaaacttaaatttagatcctgaagatagcaaagacctagatcta
gagacaaacgacctccaccttgatgactttctgacatcagggaagtttgacataattgct
tacacagacccagactcggatgacattaaaaaagacatgtttaatgaggagttagatctt
ggtgatccaatcgatgatgctgctgaatcaacaaacacaaacaaaattataagcactgaa
tcaggtaaatctatagctaccgttgctaaatctgagtgtgcaagcaaacagtccacagag
gaacccaaaccagaggtttctgggaatcgtgactctgattctttgccacctgaccaggta
gttaaatcagaggtcaaagactgtcagaggccaactaaggtggtacaccagcaagcttct
gaaaatgccacacatcagcagggggttctctctgactccaccccagtcctttctagtttg
ctcattaagcagcagcctgaagagcagtcattaaatacaatctctgcatctgtcagtcaa
ggagctaaccttatggtccagcagaaccaagtgactgatactcggcaaacctcagaacac
gctctgagtcaaacaatacctgacaccactgtgggagaagtttctgtgactggctttggt
gtagaacaacaaatggggctgagccctggagtagatcagagtggtttgagtcagacccag
cagggagggggtcaacttggccagcaacagcgcccccttctgctggaggagcagcctctt
ttattgcaggacttattagaccaggaaaggcaagaacagcagcagcagaggcagatgcaa
gccatgatacgacagcgttccagtgactcctttttccccaaaatcgattttgaaaccatc
actgaccccatcatgaaagccaaaatggtggctataaagggcatcaataaagtcatggtt
cagaacaacatgggaatgacaccaatggtcatgaacagatatccacctggacctgggcca
ccttgtcctgaaagcacacccctccctccacaagtgctcggaccggatggtaaactgacg
caagtaacaagacccaatcctccaacttttggaccaggatttgtcaacaatcctcagaga
gctcagtatgaagagtggctccaggagactcagcaactacttcaaatgcagcagaagttt
ctagaagaaaagattggcgctcatagaaagtctaagaaagccctgtctgccaagcaaaga
actgcgaagaaggcaggcagagagttcccagaggaggatgcagaacagctcaagcatgtc
acagagcagcagggtgtagtgcagaaacacctggagcagatccggaaacaacagaaagaa
catgctgaactgattgaagagtacagagtaaaacagcaacaaaacaacatgacaccgatc
atgtctgggatgcacccactgccgggctccgctggcatggtgcccgctggccccccaatg
gtgcagcctcccatcaaccccatgatgcagatgccacttcgctctggccaaccaaatgcc
cctccacgtatgcccaaccctcaacctggctggcatcctggtgctcccatgcccatgagt
ggaccaggaatgccccctttaatgcctcctcaggtacctgttgcaaatccaccccagccc
cttcaaatgccaatggctcaaatgcccatggatcctcaggcaccacatgctccacctggg
ggtgcaaagcccctgcaggcaggcggcgtaaaatttgacgacaacaacccttttagtgaa
ggtttccaggagcgagaaaggagggagagacttagggagcaacaggagagacaacgggtg
cagctcatgcaggaggtcgagcgccagagagccctgaaacatcgcatggaaatggagcag
caagggatgatgggaccagatggaaacatggcaccactcgcccagatgcctttttttaat
tctgagttgccacaagacttcatgcagcctcaaagaccctctatgccgcaatcgcatcaa
ttaggtccaatgtttcctcaacagcagggcatgcagcatggcatcagctcgccccctgga
acattcattcagggtgataggagaggcatgatggggaatgggatgatggcagctgatgtg
gggcctgataatgttccccttcagggacttggttttcctcatggtcatccgcggcctcgt
cagttcagcggaccaggactgatgccagcagagggtccgccttttgatggtgacacagcc
acaccccttccatccaactttccaggttcgggtcagtcgctcattcagctgtactccaac
attatcccagacgagaaaggcaaaaagaaacggaatcgcaagaaaaagaaggaggatgac
gcagattcagtcaagacgccatcaacgccacactcggacctcacagcccccctcacaccc
tgtgtctctgacacttcctcaactccaacaagaaacactcatctttttggagagcaggac
ttgtcgaggtcccccttactggggtcgtccactcccagtcacacagagcttgagaagcag
ctttctgcagcccagtctggacctcatggtttgccctctgagacgtccaggacccaggtc
caggaccatgacagaatactgagtaacatcaaacttgagaagacggaaacaactgagtgt
cacgggcaaagggaaggatccatctgctcagacatgagctccgtaaaggaagaggggaat
aaagggggcgtgtccccatttcctgctgagcaaagtccaaacaagggcgagtccagcaat
gagctactcaaacatcttttaaagaacaagagcacacctccacctgctctgtctcaccag
aggtcagaggaaagccttcgctctgaggagggggaaacccccgactgcaaaagctttctg
agacagagctccatggacagcagtggggcatactccgatggcacttctgactttcctggg
cctcagctgcctgaacaagagaagaagaaggggcggaacaagagacctccgaaaggagga
gaaaaacccgcctcgcgctacaagaaaaggaagaaagatagagacgagaggcagctgatg
cactctggctcggacacagtcataacgcagatcaagcaacaaagtaacttgagcaatcct
ccaacacctccggcatctcttcctcccactccaccacctgtgagtcggcagaaaatgatc
aatggatttgctacaactgaggagctggccagcaaagctgctgcgatggtctccaaaggg
ctggtgccaaagcccctgcatgtccccttcaggccagaggaagatcttcttgctcgagcc
attgctcagggtcccaaaactgtggatgttccagcttcccttcccacccctcctcacaac
aaccaggaggagctcagggggcaggaggcttgcaaggacagagacacacctgacagcttt
gtaccatcctcatctcctgagagcgtggttggcatggagatcagccgctacccagacctg
cgcctggtgaaggaagagcctctttccccctgcctgtcccctgcgttccccctgcttcct
gcccctgatgggaaagggtcagagatcaaactccaggatatcaagactgagccgtctttc
atgttcttcggttctccgcttggccccgtgtccagtgattctaagcaaggattggtgtct
gtggccatcactttgaggccggctgcagctgagaacatcaccggtgtggtagcagccatc
tcagacctgttgtgcgtgaagattcctagcagctatgaagtgagcagcaccccagacaga
gcccctctgtccatgctgaacgctcagaggatgggtcctcttggcatggaggcgcgccat
cccatgctcttccacggacatggagacgggggagggctccagggtcggcacggccagatg
atcagagccggcggcccacagggagtgatgcagcagcagggacatcagttccgtttctat
caaaacaaccaagtggtggttcttggaagtggagtgcagaaagccatcagagatctcccg
gatcacatgaaggaacctcaaatgggtttaaattcggaagaggacctggtcttttgcagt
cacagctgtttcgttctgtactgttcatcttccctgtcgcagtccaggccgatggcggca
gaaacaaaggagtccatgtcccttttgccatcctcggaccaatcggagaacctttgcaaa
gctcatcaccagtacaataacaacatgtcctcactggatgttcactgcctggccaaactg
cagccaaagcactctcccccctcgactcctcctattccctttcccgcagcagacgaggca
cccaagtccgagatcaaatcggacgccctgaaggtaactgtcaagctaaaggcccggccg
aggtcccacgatggctggcaccaggggaagagacagaaaggtctgcgctggaggaagtgg
accgttcaggtggtggtgcccagagggaattcccacctcccagatgaagataaaatcgac
gagctcctaaagaaactgggtgcctccctgcgacccccagcctccctcaaagaccaaaga
cgctgctgcttttgtcaccagtttggagatggcatcactgacggccctgctcggctgctg
aatctagacctcgatgtttgggttcatctaaactgtgctctctggtcaaccgaggtctat
gagacccaggctggtgccctcatcaacgtggagctggcgttgcgccgtggccagacgata
cgctgcgcatactgccagcagattggagccaccagcggctgccatcgccctcgctgtacc
aacatttaccatttcacctgcgctttgcaagcccaatgcacattcttcaaagacaaaacc
atgctctgccacgcccacaggcccagaggaacagggggtcaagccctggagcacgagctg
cgctgctttgccgtgttccggcgcgtttacgttcagagggatgagatgcgtcagattgcc
acggctgtgcagcagcctgagttgggttttacctttcgagtgggcagtttggtgttgcat
gcaataggccagctaactccactccagatggcctctttccattcctctacggccatcttc
ccagttggctacgaagcttgccgtgtttactggagtatgcgccatggcaaccgccgttgc
cgctacgtctgctctgttgaagacaacgacgggctgccagagtttaccatcagagtcata
gaacgaggctaccccgacctgctcctcaccgatgcttcccctaaaggggtgtgggataag
gttcttggcccagttgctgaaaaaagatcagaatcaggaactctgcagcttttcccagtt
tatctgaaaggagaggatctgtttggactcacagtacccgccgtcaccaagatcaccgaa
tcgctcccaggagtggagtcctgcgatcggtactctttccgttacggacgcaatcctcgt
ttggttttgcctcttgtgttcaatcctgctggatgtgctcgtgcccagccaagaaccagc
tctccctacacctcactggtgatcaggccacagccacaagctgcgtcaagcagcagtgcc
agatccaaccagaatgtggcccaaggagaaggcggggttcctcacagtaagactccagtt
gttcacccgagatcctcccagtaccgctggatgaagagtgagtggcgggctaatgtttat
ttgggccgctctcagatccagggcctgggcctgtttgctgccagagacattgaaaaacaa
tccatggtaatcgagtacaatggaaccatcctccgaaatgaggtcgccatcaggaaagag
aaggtttacagatcgcagaaccgagcggtgtttatgttccgcatcgacagtgaacatgtt
gttgatgccactcgaactggagggctagcgagatatatcaaccactcctgcgcccccaac
tgtgtggcagaggtggtcaccttcgagagaggttacaaaatcatcatcagctgcgttcgg
agggttgaaaaaggcgaggagggttaccaaaacgatgttgttctgcataatgcacatacc
tgcctttag

DBGET integrated database retrieval system