KEGG   Oryzias latipes (Japanese medaka): 101162801Help
Entry
101162801         CDS       T02443                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101162801
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101162801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 312 aa AA seqDB search
MTEKALDVVVVGSCMTDLVSQAPRLPKAGETIHGHKFFIGFGGKGANQCIQAARLGVKTA
MICKVGKDFFGNNYIQNFKDNEVLTDFVSQTSDEATGAASIIVNKEGENAIVIVAGANML
LGKEELQEALPAIRRAKVLLCQLEINPQTSLQALQMAREHKVKTVFNPAPAISDLDCNFY
TVSDVFCCNESEAELLTGCSVADVEDAHRAAQELQKRGCSAVIITLGSQGCVVLKAQESK
SIHVPAAAVTAVDTTGAGDSFIGALAFYMADQPAMPLEEMARRANQVAGVSVRAVGTQTS
FPSKRNLPAELF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaggctcttgatgtggtggtggttggctcctgcatgaccgacttggtgagc
caggcacccaggctgcccaaggccggcgagaccattcatggccataaattcttcattggc
tttggaggaaaaggagccaaccagtgcatacaggctgcccggctgggggttaaaactgcc
atgatctgcaaggttggtaaagacttctttggaaacaattacatccagaatttcaaggac
aatgaagtactcacagacttcgtctcgcagaccagtgatgaagctacaggagcagcttcc
atcatcgtaaataaagaaggtgaaaatgcaattgtgattgtggctggtgccaatatgctg
ctgggaaaagaagagctacaggaggcgctaccagccatcagaagagctaaagtgttgctt
tgtcagctggagatcaatccacagacatccttacaggctctgcaaatggctcgggaacac
aaagtaaagacggttttcaacccagcacccgccatctctgatttggactgcaatttctac
acagtctcagatgtgttttgctgtaatgagtctgaggcagaattgctcaccggctgttct
gtagctgatgtagaagatgcacatcgcgcagcccaggagctccagaagcgaggctgcagt
gcagtcatcatcactttgggatcccaaggctgtgtggtgctcaaggcacaggagtcgaag
tcgatacacgtcccagctgctgcagtcacagcagttgacactacgggggctggagacagc
tttatcggagccctggccttctacatggccgaccagcctgccatgcctctggaggagatg
gcgcgcagagccaatcaggtggcaggagtgagcgtgcgggccgtcggaacgcagacgtcc
ttcccctccaaacggaacctcccggcagaactgttctga

DBGET integrated database retrieval system