KEGG   Oryzias latipes (Japanese medaka): 101163204Help
Entry
101163204         CDS       T02443                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1-like
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101163204
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101163204
   04070 Phosphatidylinositol signaling system
    101163204
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101163204
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101163204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
17
AA seq 748 aa AA seqDB search
METNGIEKKLTGLEGDPDLQFLLQGGDLLKVRSRSWKKTRFLQLQEDCKTMYRKSDKLFK
SHQTFPIDDISSVRIGRQSEGLKKNTEEQLESRCFSIVFKSRRKNLDLVASSHEEAKQWV
RGLEKLLSNVNNLSRQETREHWIFNCLKKADKDKDEKLNLSEVKRFLRLINIEMDDSYAE
VLFQNCDKSKSGYLSGQEIKELYDLLSQRVEIDVIYQEYAKTTGFMSAHNLVEFLMKEQR
ERASLADAHSIIDKYEPDEQVKQKKLLSKDGFLMYMQCPEIMILNQEHKELYQDMQQPLS
HYFISSSHNTYLLEDQLKGPSSTEAYIRALMKSCRCVELDCWDGSDDEPVIYHGYTLTSK
ILFKDAIQAIKEYAFKTSNYPVILSLENHCSVEQQAVMARHLSSMLGSALVTAPLGDGMP
TNFPSPEELKGKFLIKGKRLNKLEANFTSEAAGDDTDVTEEEESSDETDEEQKKKSKLKL
AKELSDMVIYCKSVHFNGFEDAQKNLSFYEMSSFKEGKAMKLAKESANAYIHHNVEKLSR
VYPAGSRTDSSNYNPVPLWNAGCQIVALNFQTSCSEMDINQGRFLVNGKSGYILKPAFMR
DPSSEFDPNTPTPGDWRQPKTLHVMVISAQQLPKVNQKKSSIVDPLVKVEIYGVPDDMAV
KETTAIENNGFNPSWNESFQFGVSVPELALVRFVIEDYDSASSNEFVAQYTLPFTSLKMG
YRNMPLLNRNGDLLPSAGLFVHIMVLNA
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaatgggattgaaaagaaacttacaggtttggaaggtgacccggacctccag
ttcctcctgcaaggcggagatctcctcaaggtccggtcccgatcctggaagaagacccgc
tttctccaactgcaagaagattgcaagaccatgtatcgcaaatccgataaactcttcaag
tcccatcagacctttcctatcgatgacatctcgtcggtgaggatagggcgacagtcggag
ggcctaaagaagaacacagaggagcagctggaaagccgctgcttctccatcgtcttcaag
agccgccgcaagaacctggacctcgtcgccagctcacacgaggaggccaagcagtgggtc
aggggtctggagaaactcctgtctaacgtgaacaacctcagccggcaggaaaccagggag
cactggatcttcaactgcctgaaaaaggcggataaagacaaggatgaaaagttgaatctg
tcagaggtcaagaggttcctgcgtctgatcaacattgagatggacgattcttatgctgaa
gtgctcttccagaattgcgacaaatcgaagtctggatacctgtctgggcaggagatcaaa
gagctgtacgatttgctgagccagcgggtggagattgacgtgatctaccaagagtacgct
aaaaccacgggcttcatgagcgctcacaacctggtagagttcctgatgaaggagcagaga
gaaagggcctctctggctgatgcacacagcatcatcgacaagtatgagcccgatgagcaa
gtcaagcagaagaaactgctgtccaaggatggcttccttatgtacatgcaatgccccgaa
atcatgatcctcaaccaggagcacaaggagctgtaccaggacatgcagcagccgcttagc
cactacttcatctcctcctcacacaacacctacctcttggaggatcagctgaaagggccc
agcagcacggaggcttacatcagggctttgatgaagagctgccgctgtgtggagttggac
tgctgggacggctcggacgacgagcctgtgatctaccatggttacacactcacctcaaaa
atcctcttcaaagatgcaatccaagccatcaaggagtatgcgtttaagacgtccaattat
ccggttatcctctccctggagaaccactgcagcgtggagcagcaggcggtcatggcccgc
cacctcagctccatgctggggagcgcactcgtcaccgctcccctgggtgacggcatgccc
accaatttcccatctcctgaggagctcaaagggaagtttttgatcaaagggaagcgactg
aacaaactggaggcaaacttcaccagcgaggctgcaggagatgacactgacgtgactgag
gaggaggagtcaagtgatgaaaccgatgaagagcaaaagaagaagagcaagttgaagctg
gcgaaagagctgtctgacatggtgatctactgcaagagcgtacacttcaatggctttgag
gacgcccagaaaaacctcagcttctatgagatgtcgtcctttaaggagggaaaggccatg
aagctggcaaaggagtctgcaaatgcctacatccatcacaatgtggaaaagctgagccgt
gtttaccccgcaggctctaggaccgactcctccaactacaaccctgtgcctctatggaat
gctggctgccaaatcgttgccttgaacttccaaacaagctgctcagagatggacataaac
cagggtaggttccttgtcaatggcaagagtggatacatcctgaagccagccttcatgagg
gacccctcctcagagtttgaccccaacaccccgacccccggggactggcgtcagcccaag
actctgcacgtcatggtcatatcggctcagcagctccccaaagtgaaccaaaagaaatcc
tccattgtggacccgctggttaaagtggagatttacggagtgcctgatgacatggcagtg
aaggaaaccacagctattgaaaacaacggcttcaacccctcgtggaacgaaagcttccag
tttggcgtgtctgtaccagagctggcgctggtccgcttcgtcatcgaggactacgactct
gcatccagtaacgagtttgtcgcgcagtacactctgccgttcaccagcctaaaaatgggg
tacagaaatatgcctctgctcaacaggaacggagacctcctcccctcagcgggactcttt
gtacacatcatggtcctcaatgcttaa

DBGET integrated database retrieval system