KEGG   Oryzias latipes (Japanese medaka): 101163287Help
Entry
101163287         CDS       T02443                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ola00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ola04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 664 aa AA seqDB search
MCWRLSAVFVAALLASPRSSSADTYVLSDDGGLGRDFDGIGGLSGGGATSRLLVNYPEPH
RSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYEDDENYFRGYEWWLMKEAK
KRNPDIVLTALPWSFPGWLGHGKDWPYDFPDVTANYVVKWILGAKKYHDLHIQYVGIWNE
RNFDVKYIKVLRNMLDRVGLKGVGIIAADGDWSIAKSMISDPYLYNSVDVIGAHYPGTVT
VPQALKTLKKLWASEDYSTYNDAMGAGCWARILNQNYVNGQMTSTISWNLVASYYEELPF
GRCGLMTAQEPWSGNYVVSPPIWITAHTTQFTQPGWTYLRTVGHLAQGGSYVALTDGKGN
LTVVIETMTHDHSACIRPPLPAFNLTSQTATFNLRGSFASIKELQVWRSQFNFKTQKPSF
FEKLTAVKLVNGSFTLDLAEDEVYTLTTVTTGRKGSYADPPPSARFPKAYKDNFDVQDPP
FSEAPNFADQTGVFEYFVNTTDPGPHVFTMRQVVTQRPVTWTADADQTISVIGDYKWQNL
SVTCDVFMENVKNGGIFVAARVSKGGQDVRRAKGVFFWVFVNGTYKVTSDIGGQAVLAEG
KSGTEAFTWYTLSLTVEGQKATGMLNGKVLWTNSVQLQPPNGWAAIGTASFELAQFDNFS
VVAE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggcggctgtcggcggtgtttgtggccgccctcctcgcctcgccgcggtcctcc
tccgcggacacgtacgtgctgagcgacgacggggggctggggagggacttcgacgggatc
gggggtctgagcggcggaggggccacctcccggttactggtgaactacccggagccgcac
cgcagccagatcctcgattacctgttcaagccaaactttggggcatctctgcacatactg
aaggtggagattggaggagacggacaaaccaccgatggaaccgagccgtcacacatgcac
tatgaggacgatgagaactacttcagaggatacgagtggtggctgatgaaggaggccaaa
aagaggaaccctgacatagttctgaccgctttgccgtggtccttccccggatggctgggc
cacggaaaagactggccctacgacttccctgatgtcacagcaaactatgtagtgaaatgg
atccttggtgccaagaaataccacgacctgcacattcaatatgtcgggatctggaacgag
aggaattttgacgtcaagtacatcaaggtgctgcggaacatgctggacagagtgggtctg
aaaggcgtcggcatcatcgctgcagacggcgattggagcatcgcaaaatctatgatctca
gacccgtatctttataactctgtcgacgtgatcggggctcactatccgggtacagtaacg
gtcccacaggccctgaagacgctgaagaagctgtgggcatcagaggactacagcacctac
aacgatgcgatgggcgccggctgctgggctcgcatcctcaaccagaactacgtcaacgga
caaatgacgtcaaccatctcctggaacctggtggccagttactatgaggagctgccgttc
ggcagatgcggtttgatgacggctcaggagccctggagcggaaactatgtggtctctcct
cccatctggatcacagcccacaccacccagttcacacagccaggatggacgtacctgcgg
actgtgggacatctggctcagggaggaagctacgtcgccctgacagacggcaaaggaaac
ctgacagttgtcatcgaaaccatgactcatgatcattctgcctgcatcagacctcctctg
cctgcgtttaacctgacgtctcagactgcaactttcaacctgcgaggatcctttgcttcc
ataaaggagctccaggtgtggcgatcgcagttcaacttcaagacacagaagccgtccttc
tttgagaagctgactgcggtgaagctggtaaacgggtcgttcaccctggatctggctgaa
gatgaggtttacacactgaccaccgtcaccacagggagaaaaggcagctacgctgacccg
ccgccctcagctcgcttccctaaagcctacaaggacaactttgatgttcaagaccctccg
ttctctgaggctccaaactttgctgaccagactggcgtgtttgagtactttgtgaacacc
actgaccccggaccgcacgtgttcaccatgcggcaggtcgtcactcagagacccgtcacc
tggacagccgatgccgaccagaccatcagcgtcatcggagactataagtggcagaatctg
agtgtcacatgtgacgtcttcatggagaatgttaaaaacggtggcatatttgtggcagcc
agagttagtaaaggaggccaggacgtgcggcgtgccaaaggcgtcttcttctgggttttt
gttaatggcacctacaaagtgacctcagatattggtgggcaggcggtgctcgcagagggg
aagtccgggactgaggcatttacctggtacacattatccctgactgtggagggccagaaa
gccaccgggatgctgaacggaaaggtgctttggaccaatagcgtgcagctgcagccgccg
aacggctgggcggccatcggaaccgcctcctttgagctggcccagtttgacaacttctct
gtggtggcggagtga

DBGET integrated database retrieval system