KEGG   Oryzias latipes (Japanese medaka): 101163380Help
Entry
101163380         CDS       T02443                                 

Gene name
hdac6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101163380 (hdac6)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101163380 (hdac6)
Messenger RNA biogenesis [BR:ola03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101163380 (hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 826 aa AA seqDB search
CVWGCVCSWAYSILYFSIHRYEHASFWPHLPESDSSFVGSGHAIGRNINLPWNKIGMSDA
DYISAFQHVLLPVAYEFQPQLVLVSAGFDAAAGDPKGEMNVSPQCFHTLTHMLMSLAEGR
LVLVLEGGYNLKATAEGAAACVRALLGRACPPLNPPTGPSESAMHSISQTISALYVHWAF
LQVLEGTSSAEADSTKTVSGHTSTTTVAPALAAATITGLVYDERMMEHVNLWDRHHPEQP
QRIFKIFSRHQQLGLVDRCQLIQSRLATEEELAMCHSLQHIQQMSATATMKPRDLHRLGD
EFVSIFISNQSFQSAQLAAGSCFAAVEHMLNGQVNNAVAIVRPPGHHAEMDFPCGFCLFN
TTALTARHAQKVSHDLQILILDWDVHHGNGTQHIFEDDNSVLYISLHRYDNGAFFPSSKD
GAPENVGVAKGAGYNVNLAWSGGRMGDSDYLAAFHQVVMPIATEFNPGLVLVSAGFDAAQ
GDPLGGYHVTPEGYAHFTHMLMSLAGGRVLFILEGGYNLKSISDSMAACTSVLLGDPPPS
LATPLPPPHHCAAVAINKVIQHHAPYWKSLRVQIPESVRAFLPSPKHRGKHGPKGRVRKS
EQNSMGRLESSIVQSGLEQLMQGLAGLDISQSPANQSLSAVSLSVRSESDPHSDTVEEMR
VLKGDSQSRIALPQTVAEVTPEMAIPKDKPQLEGACGWAGCQKDTGLMCAEETSLYVVDP
LPWCSHLGSVKPLPPSGIDVSRPCQDCGSEAENWICLTCYQVFCGRYVNEHMVAHGKEVE
HPMVLSFSDLSVWCYMCESYIHHQVLFQAKNAAHFSKFGEESPPWK
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
tgtgtgtgggggtgtgtgtgttcttgggcatacagtatcttgtacttcagcattcatagg
tacgaacacgcctccttctggcctcacctgccagagtccgacagcagctttgttggaagt
ggacatgctataggcagaaacattaaccttccctggaacaagattgggatgagcgacgct
gattacatctctgctttccagcatgtactgctgcctgtagcctatgagtttcagccccag
ctggttctggtctctgctggatttgatgctgcagctggagatcctaagggggaaatgaat
gtgagtcctcagtgctttcacacactgacacacatgctgatgagtctggctgaaggtcga
ctggttctcgttctagagggaggttacaacctgaaggcgacagcagaaggcgctgcagcc
tgtgtccgagctttgctgggtagagcctgccctcctttgaatccccccactggaccctct
gaaagcgccatgcattctatctctcaaaccatctctgcactgtacgttcactgggccttc
ctccaagttttggagggaacttcctccgctgaggctgactcaaccaagacagtttcaggt
cacacaagcacaacaactgtggcccctgcccttgctgctgccactatcacaggcttggtc
tatgatgagagaatgatggagcacgtaaatttgtgggacagacaccacccagagcagccg
caaaggatcttcaagatattctctaggcaccagcagctgggattagtcgaccgctgccag
ctaatacagagtcgcttggcaacagaggaggagctggctatgtgtcacagtttgcagcat
atccaacagatgagtgcaacggcaaccatgaagcccagagaccttcacaggctgggggat
gagtttgtctccatcttcatcagcaatcagagcttccagtccgcccagctagctgctgga
agctgctttgctgctgtggagcatatgttaaacggacaggtaaataatgccgtggccatc
gtccgtcctccaggccatcacgctgagatggactttccctgcggcttttgcctcttcaac
acaacagcactcactgctcgccatgcacagaaagtctcccatgatctacaaatcttgatt
ctggactgggatgttcatcacgggaacgggacgcagcacatatttgaggacgataacagt
gttctttatatctccctccaccgctatgacaatggggctttctttccgtcatcaaaagac
ggtgcccctgaaaatgtgggtgtggccaaaggtgccgggtataatgtaaatttggcgtgg
agtggagggcgaatgggggactctgactacctggcagcgtttcaccaagttgtcatgcca
atcgcaacagagtttaaccccggcctggttctggtgtccgccgggtttgatgcagctcag
ggggatccacttggtggatatcacgtgactccagaaggatacgctcacttcacgcacatg
ctgatgtcacttgctggagggcgggtcctattcatcctggagggaggctacaacctcaaa
tccatttctgactccatggctgcctgcaccagtgtgctgctgggagaccctcccccatca
ctggcgacccccctccccccccctcaccactgcgctgcagtagccatcaacaaggtcatc
cagcaccatgccccctactggaagagcctgagggttcagattccagagtcagtgcgagca
ttcctgccatccccaaagcatcgtgggaaacatggtcctaaaggaagagtcaggaagtcg
gagcagaacagcatgggcagacttgagtcctctatagtgcagagtggcctggagcagctc
atgcagggattggccggtctggacatcagtcaaagcccagcaaatcagtcactttctgcc
gtctccctctcagtcagatctgagtccgacccacattcagatacggttgaagaaatgcgg
gtgctaaaaggtgacagccagtcaaggatagcactacctcagactgttgctgaggtaaca
cctgagatggccataccaaaagacaagccacagctggaaggagcgtgtggttgggcgggg
tgtcagaaagacacaggactgatgtgtgcagaagagacatctctgtatgtggttgatcca
ctgccctggtgctcccacctgggttctgtaaagcccctccctccctcaggtatagacgtg
tcacggccctgccaggactgtggatctgaggcagagaactggatttgcctcacgtgctac
caggttttctgtgggcgctacgtgaacgagcacatggtggctcacggcaaagaggtggag
caccccatggttctgagcttctctgatctttctgtgtggtgttacatgtgtgagtcctac
atccaccaccaggttctgttccaggccaaaaacgctgcccacttctccaagtttggagaa
gaaagccctccatggaaatga

DBGET integrated database retrieval system