KEGG   Oryzias latipes (Japanese medaka): 101163392Help
Entry
101163392         CDS       T02443                                 

Definition
(RefSeq) CREB-binding protein-like
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101163392
   04330 Notch signaling pathway
    101163392
   04350 TGF-beta signaling pathway
    101163392
   04068 FoxO signaling pathway
    101163392
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101163392
  Cellular community - eukaryotes
   04520 Adherens junction
    101163392
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101163392
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101163392
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101163392
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101163392
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101163392
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101163392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 2618 aa AA seqDB search
MAENLLDHGPPSTKRPKLNSPALSASDGQELGSLSWDDLENDLPDELIPNGGEYSHMGGA
TGPGGTSAGLSGNGGASIVPDAAAKHKQLSELLRTGSTANITGTGLSSGSPQPGGIGTQL
GTPLGKSPLGQGSPNSHPSPQAQKAGTPTGVAGQNTSNTTATMGLSTTGFTQTMINNNQG
HAGLHNQGGQPQPGQVINGGIVPGTGRGRGAGVAGMQYQGQTLQATAPGATGSALAETLT
QGGQQIGAHPTLGAAQQAGNMNKLGLGSNGGPFGAQSYGQGAAGPGQQLTSQQLQSKAAL
ANSLPPFPNEVKGAAVTNIPNMQPQQQAAMLPLANSGGVAVPSAGPTADPEKRKLIQQQL
VLLLHAHKCQRREQANGEMRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISH
WKNCTRHDCPVCLPLKNASDKRTQQPMVSSPNPGLPNPMSSVGVGQPSAPAINTSAPIDP
SSMQRAYAALGLPYSSTATGQNPAQQVPGQTAGPQSSQPQQQLQQQMRSINAIGNQITLG
GVTTSEQTNLLTDSLPNTLNNQLLSDGSAVGTMGNLPTASPIASTGSRKAWHEHVTQDLR
NHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHFLAEKIYKI
QKELEEKRRSRLQKQIINQASITQGTQQPGVPQAPALGARPQNGPGSLPNIPNPIINRMQ
VSQGVNQFNHLAMTNQMTPAQMGPRAASPMNHPQQMNLSSVPQMGMSPSRMPQAQGLMAG
HNNMVGQTASQGQFMTQTQFPPGSGASGAMSVAAGPGMGQPPAQAAITQLSQPGASLDNR
VPTPASAASADLHSQHAAADLPVQEVKTETQHGQQEFEAAGMKTEAKMETEDDSTSSSVK
KEEQEVKDEQMEVEEKKLVMKKEPKDEEESGSNGTSSSSPTQFRRKIFKPEELRQTLMPT
LESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDV
WLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQ
LCTIPTGGTYYSYQNRYHFCEKCFNDIQGDSVTLGDDPAQPQTMISKDQFERKKNDVLDP
EPFVECKDCGRKMHQICVLHYEVIWPSGFICENCLKKSGKTKKENKFTAKRLQSTRLGMH
IEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMPETFPYRTKALF
AFEEIDGVDVCFFGMHVQEYGSECSFPNNRRVYISYLDSIHFFRPRILRTAVYHEILIGY
LEYVKKLGYAQGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERILH
DYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTAASEMPEG
TPSDSKNAKKKNNKKTNKNKSSISRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHL
HSGPMVNTLPPIVDPDPLISCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHN
QGQDRFVYTCNECKHHVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDNNGQS
GEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCP
VCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMQGRTM
PLFDLQELQQLCRLQPKDATTKDPEEDHTDQAFVDLLRSMWDEEEDEAAELDEGGGDGKP
AVEDRGADEVILYDREIGEERINEEELEEIYEFAATQKKEEEEESEEEEQEEAMIITHLF
EPRKSFIETVQLESDQFLDRCGSKSQTVHQETEASSTSNRTPTRSREGEGSDRPVLQSSG
SSLSPPPRTFSLPGPGLSPAHVDGHDHRDAAAELDEPLKHQSPDAVCPPSFLQKEEPEFI
VLSDSGEENHNVPCSPDKNLQSYTQIRSRQDSSPAEERKESRGLDFGPVDPPVCSPEVSW
LSFTPVQAERSSRSSSTQTRSSMCRTKLFSRVDSSSGFSSPTCNRHRDVSASSSQSCQPP
ARLKQSQLLLRSEDEERPHSQPCISTPLQTDHHHPADLLAASPLLPDNKPSQRRRSSENS
DWRRLHVSPQSKPAASSSSSSPSRRPPSESSSCDSPGVRVQRMEAGSDADAEQEEGKGPN
GAESGEASLQQSFTDEPPIAYNDSWGLDVYEDAGPACFSLRLEDGSGSSLQEQHEASRSS
SSAPSELLPAGHRGQPGPRGVRSNSARQSPRPQSSRRSSTASPPYSGRTPPKIQASLLDS
QLWDSWGEDDEVLPLSQRVNPAKHLKTPAPSHRKRRVSVVPITPMPSFSDMDTPELKGKL
NRFGVRPLPKRQMILKLKEIHQYTHQLASSDSEEDPPPHMRDPPGMSCGQTGTFKEPRAP
AAASAVEPGHGADPGQLSASQDSNTSSAACSDESERSNQEFFLSSDGDSDSDGCISSSQA
ATRLQDRLQAVRNFILSNPELYSQILQYRPLVLPRLQEQLKAAGIRLGAAKLVDYLDSQC
ITFTTAKPGRPGKPAARGNRAGRGAKAASRKKAATGIP
NT seq 7857 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacttactcgatcacggacctcccagcaccaaacggccgaagctgaattca
cctgcactgtcagcgtctgatggacaagagctcggatcgttgtcctgggatgatttggag
aatgaccttcctgatgaattaattcccaatggaggggaatatagccatatgggtggagct
actgggccaggcggcacctcagctggtctgagtgggaatggtggtgcctctattgtccca
gatgctgctgcaaagcataaacagctctctgaacttcttcggacgggtagcacagccaat
atcacaggcactgggctcagctctggcagccctcaacctggtggtattgggacacagctg
ggaacaccgctgggtaagagcccgcttggccagggctctccaaacagccacccatcaccc
caggcccagaaggcaggaacacctactggagtagcagggcagaataccagtaataccact
gcaacaatgggcttgagcacaactggtttcactcagactatgataaacaataaccagggt
catgccggactccacaaccaagggggtcagcctcaacctggtcaagtgataaatggcggg
attgtacctgggaccggaagaggacgtggtgctggagtagcaggcatgcagtaccaggga
cagacattacaggcaacggcaccaggagcaactggaagtgctttggcagaaacactcact
caagggggacagcagattggagctcatcccactcttggtgctgcccagcaagcaggcaac
atgaacaagctgggcttgggtagcaacggaggtccatttggggctcagtcgtatggtcaa
ggtgctgcgggaccgggccagcagctaacctctcagcagcttcagagcaaggccgctctc
gccaacagcctgccgccgttccctaatgaagtcaaaggggccgctgtcaccaacatccca
aatatgcagccacagcaacaggcagctatgctcccactggccaacagcggcggagtggcg
gtcccttcggcgggcccaacggccgatcctgagaagcgcaagctgatccagcagcagctg
gtcctgctgctccacgcacacaagtgccagcgtcgggagcaggccaatggggagatgaga
gcctgtgctctgcctcactgccgcaccatgaagaacgtcctcaaccacatgacgcattgt
caggctggcaaatcctgccaagtggctcattgtgcatcgtccagacagatcatatcccat
tggaaaaactgcacacggcacgactgtcctgtctgcttgcccttaaagaacgccagcgac
aagcgcacccaacagcctatggtgagctccccaaacccaggccttccaaaccccatgtcc
tcggttggtgtggggcagcccagcgcccctgccatcaatacctcagctccaatagacccc
agctccatgcagagagcctacgctgcccttggtttgccctatagcagcacagccaccgga
cagaacccagcccagcaggtcccaggacaaacggccggtccccagagctcccagcctcag
cagcagcttcagcagcagatgagatccatcaatgcgattggtaatcagattactcttgga
ggtgtgaccacgtcagaacagaccaatctgctcaccgactctcttcccaacacacttaac
aatcagctgctgtctgatggatcggctgtgggaacgatgggaaatctacccacagcatcg
cccatcgcctccacaggctccaggaaggcctggcatgaacacgtcacccaggacctgcgc
aatcacctcgtccacaaactagtacaagccatatttcccaccccggatccggcagctctg
aaggacagacgaatggagaacctggtggcttatgcccggaaggtagaaggggacatgtac
gagtccgccaacagccgagacgagtactatcacttcttagctgaaaaaatatacaaaatc
caaaaggaactggaggagaagaggcgttcaaggttacaaaagcagatcatcaatcaggca
tcaatcactcaggggacacagcaacccggcgttccccaagcccctgctttgggtgcaagg
ccgcagaatggacccggttctctaccaaacattccaaatccaatcataaatcgcatgcag
gtctcacaaggagttaaccagttcaaccacttggccatgacgaaccagatgactccggca
caaatgggaccccgagctgcctccccaatgaaccacccacagcaaatgaacctgagctcc
gttccacagatgggcatgtctccctcaagaatgcctcaggcccagggcttgatggccgga
cacaacaacatggtggggcagacggccagccaggggcagttcatgactcagactcagttt
cctcccggatcgggggcgtcgggggccatgagcgtcgctgcagggcccggtatgggccag
ccgccagcacaggcggccatcacccagctgtcccagcccggggccagcctggacaaccgc
gtgcccacgcctgcctccgcggcgagcgcggacctccactctcagcacgccgcggcagac
ttacctgtccaggaggtcaagacggaaacgcagcacggacagcaggagtttgaggctgct
ggcatgaaaactgaagccaaaatggagactgaagatgactccacttcaagttccgtgaaa
aaagaagagcaggaggtgaaggacgagcaaatggaggtggaggagaaaaagctggtgatg
aagaaggagccgaaagacgaggaggagagtggaagtaacggaacgagctcctcctccccc
acccagttcagacgaaaaatatttaaaccagaggagctgcgtcagactctgatgccgacg
ctggagtctctctacaggcaggatcccgagtctctgcctttccgacagcctgtagacccc
atgctgctgggtattcctgactactttgacatagtgaagaacccaatagacctgtccaca
ataaagcgcaagctggacacggggcagtaccaagaaccctggcagtatgtggacgatgtg
tggctgatgttcaacaacgcctggctctacaaccgaaagacctcccgggtctacaagtac
tgctccaagctggcagaagtcttcgagtcggagatcgacccggtcatgcaaagtctgggc
tactgctgtggaaggaagtacgagttctcccctcaaaccctctgttgctatggaaagcag
ctgtgcaccatccccactggaggcacctactacagctaccagaacagataccatttctgt
gaaaaatgcttcaatgacatccagggggacagtgtgactttaggagacgatcctgctcaa
ccacagacgatgatatcaaaggatcagtttgaacgtaagaagaacgatgtgctggatcct
gaaccttttgttgaatgtaaagattgtggacgaaaaatgcaccagatctgtgtattacac
tacgaggtgatatggccttccgggttcatctgtgaaaactgtctaaagaaaagtggaaaa
actaagaaggaaaacaagttcacagcaaaaagactgcagtcgacaagacttggaatgcac
atagaggaccgcgtgaacaaatatctgaaacgacagaaccatccagaggccggagaagtc
tttgtcagagtggtggcgagctctgacaaaacggtggaagtcaagccgggcatgaaagcc
aggtttgtggacaccggggaaatgccagagacctttccttatcgaaccaaagcacttttt
gcctttgaggaaattgacggcgtggacgtttgcttcttcggcatgcacgtgcaggagtac
ggctccgaatgctcgtttcccaacaacagacgtgtctacatatcctacctggacagcatt
cacttcttcagacctcggattttaaggactgcagtctaccatgagatactgatcgggtat
cttgaatacgtcaaaaagctgggctacgctcagggccacatctgggcgtgtcctcccagt
gagggagacgactacatcttccactgccacccccccgatcagaagatccccaagccaaag
agactccaggagtggtaccgaaagatgctggacaaagccttcgcagagaggatccttcat
gactacaaggacatcttcaaacaagcaaccgaagaccgacttacttccgccaacgagctg
ccgtactttgaaggcgacttttggcccaacgttctggaggagagcattaaggagctggag
caggaggaggaagagaggaagaaggaggagaacacggctgcctctgaaatgcctgaggga
accccgagcgacagcaaaaacgctaagaagaagaacaacaagaaaaccaataaaaacaag
agcagcatcagccgagccaacaagaagaagcccggaatgccgaatgtagccaacgacctg
tcccagaagttatacgccacgatggagaagcacaaagaggtgttttttgtaatccatctc
cactcgggtcccatggtcaacactttgcctcccatcgttgaccctgaccccttgatttcc
tgtgacctcatggacggccgcgatgccttcctgactttggcgcgggacaaacactgggag
ttcagctcgctgcggaggtgcaagtggagcacgatgtgcatgctggttgaactgcacaac
caaggacaggatcgcttcgtctacacgtgtaatgagtgtaagcaccatgtggagacccgc
tggcactgcaccgtgtgtgaggactttgatctttgcattaactgctacaatacgaagggc
cacgagcaccagatggtgaagtggggtctcggccttgacgatgacaacaacggacagagc
ggcgaggcctcgaagagcccgcaggagagccggcgcctcagcatccagcgctgcatccag
tccctggtccacgcctgccagtgtcgcaacgccaactgctctctgccctcctgtcagaag
atgaagagggtggtgcagcacaccaagggctgcaagcgcaagaccaacggaggctgcccc
gtgtgcaagcagctcatcgccctgtgctgctaccacgccaagcactgtcaggagaacaag
tgccccgtcccgttctgcctgaacatcaagcacaagctccgccagcagcagatccagcac
agactccagcaggcccagctgatgaggagaagaatggccaccatgcaaggcagaaccatg
ccactgttcgatctgcaggaactgcagcagctttgtcgcctccagccaaaagacgccacg
acgaaggacccagaggaagatcacacagaccaggccttcgtagacctgctcagatctatg
tgggatgaagaggaggatgaagctgcagagctggatgaaggtggtggtgatggcaaaccg
gcggtggaggatcgtggagccgacgaggtcattttatatgacagagagataggcgaggag
cgaataaatgaggaagagctggaggagatctatgagtttgcagctacacagaagaaggag
gaagaggaggagagtgaggaggaggaacaggaagaggccatgatcattacacatttgttt
gaaccgcgaaaaagcttcatcgaaacagttcagttggagtcagatcagttcttggatcgc
tgtggttcaaaatcccaaaccgtccaccaggagacagaagcctcttctacctccaaccgg
actccgactcggtccagggaaggggagggttctgacagacctgtccttcagtcatcagga
agttccctcagtcccccacccaggaccttcagcctgcctggaccaggactgtctcctgct
catgtggatggacatgaccacagagatgctgctgctgaactggacgagcctttgaagcac
caaagtcctgacgccgtctgccctccttcctttctgcagaaagaggaacctgagttcatc
gttttgtctgattcaggggaggagaaccacaatgttccttgttctcctgacaagaacctg
cagagctacacgcagatccgatccaggcaggactcctcacccgcagaggagagaaaggag
tccagaggcctggactttggtcctgttgatccaccagtgtgttctccagaggtgtcctgg
ctgagcttcactccagtccaagcagagaggagctcaagaagcagctctactcaaactaga
agcagcatgtgcaggaccaagctcttctccagagtggactcctcctcagggttctcctct
cccacctgcaaccgccaccgggacgtttctgcgtcttcatcgcagagctgccagccacca
gccaggctgaagcagagccagcttctactcaggagcgaggatgaagagcggccccattcc
caaccatgcatcagcacccccctgcagacggaccaccaccaccccgctgaccttctggct
gcctcccccctcctccccgacaacaagcccagtcaaaggaggagatcctccgagaactcg
gactggagacgacttcacgtctcccctcagtctaagccggctgcttcatcttcatcttca
tcacccagcaggagacctccctctgagagctccagctgtgacagtccaggtgtcagagtt
cagaggatggaagcaggaagtgatgctgatgctgagcaggaagagggaaaaggtccgaat
ggagcggagagtggagaggccagccttcagcaaagcttcacggacgagcccccgatagct
tacaatgattcatggggtctggacgtctatgaggacgcgggtccggcctgcttcagtctg
agactggaagatggttctggatccagcctgcaggagcaacatgaagcctccagaagctcc
agctcagctccgtctgagcttctccccgccggtcacaggggtcagccaggccccagaggg
gtgaggtctaactccgcacggcaaagtccacgaccgcagtcgagccgtcgctcctccaca
gcctcaccgccttacagtggccgcaccccgcctaaaatccaggccagccttctggactct
cagctgtgggacagttggggagaagatgatgaagtccttcctctgtctcagagggtgaac
ccagcaaagcacctgaaaaccccagccccatctcacagaaaaaggcgtgtcagcgtggtt
cccatcacaccaatgccatccttctctgacatggacacgccagagctcaaaggcaaactc
aacaggtttggggtccggcctttacccaaacgtcaaatgatcctcaaactcaaggagatt
catcagtacacacaccagctggccagctccgactctgaggaggacccgcccccccatatg
agggacccccccggcatgtcctgcggccaaacggggacgtttaaggagcccagagctcct
gctgctgcgtctgcggtcgagcccggccatggggcggatccagggcagctttctgcatcg
caggactccaacacgtcttcagccgcctgcagcgacgagtccgagaggtccaaccaggag
ttcttcctctcttctgacggcgactcggacagcgatggctgcatttcgtcctcgcaggca
gcaacgcgtctccaggaccgcctccaggcggtccgcaacttcatcctgtccaaccccgag
ctgtacagtcagatcctgcagtaccgaccgctggttctgccccgcctccaggagcagctc
aaggccgctgggatccgcctgggcgctgccaaactggtggactacctggactctcagtgc
atcaccttcaccacggccaagccaggcaggccaggcaagcctgcagccaggggcaacagg
gccggcaggggggcaaaagcagcaagcaggaaaaaagcagcaaccggcattccttaa

DBGET integrated database retrieval system