KEGG   Oryzias latipes (Japanese medaka): 101163866Help
Entry
101163866         CDS       T02443                                 

Definition
glycogen [starch] synthase, liver-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101163866
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101163866
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101163866
Glycosyltransferases [BR:ola01003]
 Polysaccharide
  Storage polysaccharide
   101163866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
23
AA seq 701 aa AA seqDB search
MPLSRSLSMTSLSGVLPAWEEDQLPVEDLLLFEVAWEVANKVGGIYTVIQSKAKVTVDEW
GENYFMMGPYFEHNFKTQVEGCEPPNAAIRNAMDALIHNGCQVHFGRWLIEGNPFVVLFD
IGSAAWNLDRWKGDLWDTCHIGLPFHDREANDSLILGSLIAWFLRELTNHLEGKKNIICH
FHEWQAGPGLILSRSRKIPMATIFTTHATLLGRYLCAGNVDFYNNLDKFDIDKEAGERQI
YHRYCLERAAVHCSHVFTTVSQITAVEANHILHRKPDIVTPNGLNVKKFSAMHEFQNLHS
INKARIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFTNKGADIFLESLSRLNYLLRVHRN
DMTVVVFFIMPAKTNNFNVESLKGQAIRKQLWDTAHTVKEKFGKKLYDALLKGHIPDMNN
ILDRDDFTIMKRAIFATQRHSLPPVTTHNMEDDSTDPILSNVRRIGLFNSRNDRVKIIFH
PEFLSSTSPLLPMDYDDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFM
EEHISDPTAYGIYIVDRRFKSPEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDW
RYLGRFYVHARQLALSRAFPDKFKMDTILKTEGFRYPRPYSVPPSPSASLHSTPHHSDAE
DEDDDAYDEEEEAERDRVNIKAPFALGAVPDGEKQPGESRN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgtcgcgctcactgtccatgacctccctgagcggggtgctgccggcctgggag
gaggaccagctgcccgtggaggacctgctgctctttgaggtggcctgggaggttgccaac
aaagttggagggatctacactgtcattcagtccaaggctaaggtcacggtggatgaatgg
ggagaaaactatttcatgatggggccctattttgagcacaacttcaaaacccaggtggag
ggctgtgagccccccaacgctgccatccgcaatgcaatggatgccctcatccacaacggc
tgccaggttcactttggccgctggctgatcgagggaaacccttttgtggtcctgtttgac
atcggctcagcagcctggaacctggaccgttggaagggtgacctgtgggacacctgccac
attggcttaccgttccacgaccgagaggccaacgactctcttatcctgggctccctgatc
gcctggttcctcagagagttgacaaaccacctcgagggcaaaaaaaacatcatctgtcac
ttccacgagtggcaggccggccccggcctcattctgtcccgctctcgaaagattcccatg
gcaacgatcttcaccacacatgccacccttcttgggagatacctgtgtgctgggaatgtg
gacttctacaacaatctagacaagtttgacattgataaggaggctggagagcggcagatc
taccatcggtattgtttggagcgcgccgccgtgcactgttcgcacgtcttcaccacagtc
tcccagatcacagcagtggaggccaatcacattcttcacaggaaaccagatatcgtgacc
cccaatgggttgaatgtgaagaagttttctgccatgcatgagtttcagaacctgcactcc
atcaacaaggcccggattcaggagtttgttagaggacacttctatggtcatcttgacttc
aacttggacaaaacactcttcttcttcattgctgggcgatatgagttcaccaacaaagga
gctgacattttccttgagtcactttccagactcaactaccttctgcgggtccacaggaat
gacatgaccgttgtagttttcttcatcatgcctgctaaaaccaacaacttcaatgtggag
tccttaaagggccaagctatacggaaacagctctgggacacggctcacacagtgaaggaa
aagtttggtaaaaagctctatgacgctctactgaaaggacatattccagacatgaacaac
attctggaccgagacgacttcacaatcatgaagagagccatctttgctactcagagacac
agccttccaccagtgaccacccacaacatggaggacgactccacagaccccatcctgtcc
aacgtccgccgcatcggcctcttcaactccaggaatgaccgcgtcaagatcatcttccac
ccagagttcttgtcttccaccagcccgctgctacccatggactatgatgactttgtccgt
ggctgcaacctgggagtgtttccttcttactatgaaccatggggatacacacctggtgag
tgcacagttatggggattcccagtgtgaccacaaacctatcaggttttggctgcttcatg
gaagagcacatctctgaccctactgcctatggtatctacattgtggaccgccggttcaaa
tccccagaggagtcctgcaaccagctgacccagttcatgtttagcttttgccagcagtcc
cggcgccagcggatcatccagcggaacagaactgagagactatccgacctgctggactgg
agataccttggacggttctacgttcacgcccgccaactggccctgagtagagctttcccg
gacaagttcaaaatggacaccatcttaaagactgaaggttttcgatacccaagaccctac
tccgtgccaccctccccctccgcctccctccactccaccccccaccacagtgacgctgaa
gatgaggacgatgacgcatacgatgaagaggaggaggcagagagggaccgggtgaatatc
aaggctccattcgcactgggcgcggttccggatggggagaagcagccgggagagtccagg
aactga

DBGET integrated database retrieval system