KEGG   Oryzias latipes (Japanese medaka): 101163999Help
Entry
101163999         CDS       T02443                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101163999
Peptidases [BR:ola01002]
 Cysteine Peptidases
  Family C86
   101163999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 184 aa AA seqDB search
MSEAEVFHEKQRLELCAIHALNNVLQERVFTKETADDICKRLAPQCVVNPHRSVLGTGNY
DVNVIMAALQSRELAAVWWDKRRTVQSLCPSKVQGFILNVPSRVSLGIVSLPLRRRHWLA
VRQVNGQYYNLDSKLKNPFCIGGEAELRGFLSEQLSQEVAEMLLVVRREVEDDGSWLNSD
SPKE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagccgaggtgtttcatgagaagcaacggttggagctgtgcgccattcacgcg
ctcaacaacgtgcttcaggagcgagtgtttaccaaggagacggctgacgacatctgtaaa
cggctggctccacagtgtgtggttaacccccatcgatcagtgttaggaacaggaaactat
gatgttaatgttattatggcagcgctacagagcagggagctggctgcagtgtggtgggac
aaacgcaggacagttcagagcctttgcccatccaaggtccagggctttattcttaatgtt
ccatctcgagtatctttgggaatcgtttccctccccctccgaaggcggcactggcttgca
gttcgacaggttaatggacagtactataacctggactccaagctgaaaaatcctttctgc
ataggaggagaagcagaactacgtggttttctcagtgagcagctttctcaggaggtggca
gagatgctcctggttgtacgacgggaggtggaggacgatgggtcttggctaaactctgac
tcccccaaggagtga

DBGET integrated database retrieval system