KEGG   Oryzias latipes (Japanese medaka): 101164102Help
Entry
101164102         CDS       T02443                                 

Gene name
plce1
Definition
(RefSeq) phospholipase C, epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101164102 (plce1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101164102 (plce1)
   04070 Phosphatidylinositol signaling system
    101164102 (plce1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101164102 (plce1)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101164102 (plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
19
AA seq 2260 aa AA seqDB search
MMATEEHQMQAGPDMLSKRSSPPSIGSRPLRDKALTSSGQEVWRGCDQLWLSKQRSSPSL
LFYRKLSCESVNGVHSAEECVEYSYSSQILSTKEKPLPEPSADKNCEGMKNILGDSESTK
PDRTSSSHVPSDHSTSVYTNSDSKSSPSFCTSCPNKRHIRRGSLPVSMLAFYKTSSHRSF
PGEPSSEPGSLASSPCGSPRLNHRQHPHQGNLKDGFSSLERLNRRPRVQKCPLEKLFLPR
SLAATMTLDSSFPGTISCGRDSSNEEEDEEAPLDEAEFLRNRKDRSTVLVRRFFKNNQKV
TKSVCAGTIAIVRTLPSGHISDDVWGIVVDHRCWHPSKKDVWSVLQRGEELRGCRGILHF
DKAKLQQVNNYVKSREECSLIHPANKLLLSWPGCVHLRDPPRPLNVVNNSSARPDLHHRC
DPARFYLACGWRTSLCSLLTGAILEATVAIGARSSLLCPPPQCPNSHAVLKERQLANSMT
SSISLPQNVSGISKELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSP
ECQIKRHPNLKASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREV
FSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMDQSDIETIRSLKDAMAQHETS
SEYKKVMTRALNIPGCKVVPFCGVFLKELSDALDGTASIISLKQSPDNTDDSVEFMSDYS
GQHHFMTRSGPDGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSN
SLKDRYRNQFTVGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPD
VHQFLLQGATVIHYDQDSHLTARCLLRLQPDNTTLTWGKPQSGGASPTEQPLGLGQTVMA
GLAEGLLDLGVVKAVFLGHQGVDVQAVCLQNKLSQMTVEENGLSLLYGLSTTDNRLLHFV
APNHTARMLHRGLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELF
GGRRWNMGTAGVEKPGGQKNSPLSINDKSKKKKKVFARGDSGDATDDEMVSRKTRSCKEA
LNRNGPESESVDHEDPDDSFPGTLSLSSSKSPGLLASSSSSSSSSSMTGSNHCRPQSSPV
LSGTSKSQPGAWSSRSWHGRGKGCFKSFQNLMISDSTMSFIEFVELFKSFSIRSRKDLKE
LFDTFAVPCSRSCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQ
KQISDAIAAASIVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEP
SSVMRQMGWMSFEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQ
LKGESSVELYSHVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFV
NSDMPVILSIENHCSLPQQRKMAEIFKNVFGERLVTRFLFESDFSDDPHLPSPLQLRGKI
LLKNKKLKAHQAPVDILKQKAHQLAHMQAQASNGSPGVSSPHNHNNEDEEEEEDEYDYDY
ESLSDDNLLDDKADAKNSVDKEELHADDIPKRMKKPDSAVQSKGKVFDMELGQEFYLPQN
KKESRQIAQELSDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGE
VTSQSRTPGKGSSERLSWEEQQTSPVLNPPTSLSAIIRTPKCYHISSVNENAAKRLCRRY
SQKLIQHTACQLLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFEL
NGGCGYVLKPAVLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCI
EVDVLGMPVDSHHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQR
TLPLTALKPGYRHVQLRTQHNESLEVSSLFIYSRRTDEGPIGGATPSSLLFSSEERHLSQ
QHKVTVHGAPGPEPFAVFCITDQTTAKQLLDTVVATTGNPSAHILCEEKVPLLKERSEVK
RCAQYRFLAPEEEVVRLVSSWDMEEGYVGRICLKTKEENLNEKNTELETEEETTAGSKDG
AAGEEDMFFVQVHEVSPEQPHTVIKAPRYSTAQDIIQQTLSKAKYSLSNSNPSEYVLVEE
VTKDSASKKSSATKPLQRVLLDHECVFQAQSRWRGAGKFILKLKDQVVREDKKKVISFAS
ELKKLTSRSRSMTTGVGVDGPGQSKEERAACCVALTELQE
NT seq 6783 nt NT seq  +upstreamnt  +downstreamnt
atgatggccactgaagaacatcagatgcaagctggacctgacatgctttcgaagcgttct
tcccctccttccatagggagcaggcccctcagagataaggcgcttacaagttctggacag
gaagtatggcgaggctgtgaccagctgtggctctcaaaacagcggagtagcccctccctc
cttttctacaggaagttgtcatgtgaaagtgtgaatggggttcattctgctgaggagtgt
gtggagtatagttacagctcgcagattttgagtaccaaagaaaaacctttgccagaaccg
tcagctgataagaactgtgaagggatgaagaacattttgggggattcagagagcaccaaa
ccagacagaaccagctcctcccatgtcccgtctgaccattccacaagtgtgtacactaac
tctgactctaaatccagtccaagtttctgcacttcttgccccaataaacggcacatccgg
cgtggcagccttcctgtttctatgctagcattctacaagacatcctctcaccgctccttt
cctggagagccttcaagtgagccgggctctttggcgtcgtctccatgtggctccccccgt
ctcaaccaccggcagcatccccatcaaggaaaccttaaagacggattctccagtttggag
agactcaaccgaagaccccgcgttcaaaaatgccctttggagaaactgttccttccacgg
tccttggcggctaccatgaccctcgactcatcctttccaggaaccataagttgcggcagg
gacagcagcaatgaagaggaagatgaggaggctcccttggatgaagcagagtttttaaga
aaccgcaaggaccgttctactgttctcgtgaggcggttcttcaagaataatcaaaaggtg
accaaatccgtgtgtgcgggaaccatagcgatcgtcagaactctgccctcagggcacatt
tccgacgatgtctgggggattgttgtggatcacagatgctggcatcccagcaaaaaggac
gtgtggtcagtcttacagcgtggagaagaactcagagggtgtagagggatattacacttt
gataaagcaaaactgcagcaggtaaacaattatgtgaagagcagggaggaatgcagcctc
atccatcctgccaataaactcctgctgtcttggcctggatgtgttcacctcagggatcct
cccagaccactgaatgttgtcaacaacagctcagcgcggcctgatcttcatcatcgctgt
gatccagcaagattctaccttgcctgtggttggaggacgtcgctgtgttccttgctgaca
ggagccatcttagaggccaccgtggctatcggtgcccgctcttctttgctttgtcctcca
ccccagtgtcccaacagccacgctgtgctgaaagagcgtcagctcgccaacagcatgacc
agcagtatctctcttcctcaaaatgtcagtgggatcagtaaggagctagcagagctgcga
cacctcatccagttccccgaggagattgcctgtatcctcactgagcaagagcagcagctt
taccagcaggtgttgcccctggactacctctgtttcctcacgcaagatctgggcagtcct
gaatgccaaattaaacgccacccgaacctgaaggcgtctctgtcagcacctaacatgcca
acccagagtcctcggaggagtaacgctgtggaggacctggtggctcgcttcaatgaggtg
agttcttgggtgacgtggctggtcctgacggccggtaccatggaggagaagagggaagtt
ttttcatacctggtccatgtggccaaatgctgttggaacatgggaaactacaacggcgtc
atggaattcctggctggactcagatcccgtaaggttctgaaaatgtggcagttcatggac
cagtcagacatcgaaaccataagaagtttaaaggacgccatggctcagcacgagacatct
tctgagtacaagaaggttatgaccagagcgctcaacatcccgggatgcaaggtggtgcct
ttttgtggcgtctttctcaaagagctgagcgatgctttggatggcacagcgagcattatc
agcctcaaacaatctccagataacacagacgactcagtggagtttatgtcagactacagc
ggtcagcaccatttcatgacccggtcgggtccagacgggctgcatgtgccggagaaagag
gcaactgttagcaatatcctgcagatcatcaggtcttgcaatcgcagtttggaggcagat
gatcctgacgacacatccagcagcccttcctctggcacaaccctcgcgttcagaagcaac
tccttgaaggaccgctatcgcaatcaattcacagttggggacctgtcggactcggatggc
gacttgtcagtggaaccagtcataaaggaggtggagtttcaggggactgaggagacccac
aaggcgttcagccatggcacagagctcattccatggtatgtgttgtcactacaacctgac
gttcaccagttcctgctgcagggagccacagtcattcattatgaccaggacagccacctc
acagcccgctgtctgctgcgcctgcaacctgataacacaacgctcacctgggggaagcct
caaagcggaggcgcttctccgacagagcagccgctggggttagggcagactgtgatggct
gggttagcagaaggccttttggacctcggggttgtaaaggcggtctttttgggtcatcag
ggagtcgatgtccaggctgtgtgtttgcaaaacaagctgagccaaatgacagtggaggag
aacggtctttcccttctctatggtctcagtactactgacaatagacttctgcactttgtg
gcccccaaccacacagcgcggatgctccatagaggcctatcagagttggtaaatgcaagc
aggaagatgaaaaggtttcccgaccaaagattacagtggctgaggaggcagtatgtcagt
ttgtatcaggaggatggcaggtatgaagggccgacgttggcccaggccattgagcttttt
ggcggccggcggtggaacatgggtacagccggtgtggagaaacccggcgggcagaaaaac
agcccgctgagcatcaacgacaagtccaagaaaaagaagaaggtttttgcaaggggggac
agtggggatgccaccgatgatgagatggtttccaggaagacgcgaagctgtaaagaggcc
ctcaatcggaacggcccagagtctgaaagcgtcgaccatgaagatccagatgacagcttt
cctggaacattgtccctctcatccagtaagagccctggcttgctagcctcctcttcctct
tcatcctcatcctccagcatgacaggatccaaccactgccgcccacaatcctccccagtt
ctttcaggaacgtccaagtcacagcccggcgcttggagcagcagatcgtggcacggccga
ggtaaaggctgcttcaaaagcttccagaacctcatgatctctgacagcaccatgagcttc
attgaatttgtggaactcttcaagtcattcagtattcggagcaggaaggacttgaaagag
ctgtttgacacctttgcagttccctgcagtcgctcgtgctcagagtcgcccccactttac
accaaactcaggatagatgacaatgacacgggtctacagtcagacctcgaccttttaact
cgaaacggttctgatcttggcctgttcatccgcacgcggcagcacatgtctgacaaccag
aagcagatctcagacgccattgcggcagccagcatcgtaaccaacggcacaggggtggag
aacgcatcgttgggggtcttgggattggcgatccctcaactcaacgactttctagtgaac
tgtcagcgagaacacctcagctacgacgagattctcagcatcatacagaaatttgaacct
tcttccgttatgaggcagatgggttggatgtcatttgaaggttttgcaaggttcctgatg
gacaaagacaactcggcttcccgaaatgaggaatcccagatgaatccagaggggctgcag
tacccactgtcatactactacattgaatcttctcataacacgtatctgactggacatcaa
ctcaaaggagagtcttctgttgagctttatagtcacgtgctgcttcaaggttgtaggagt
gtggagctggactgctgggacggagatgacggcatgccagtaatttaccacggacacaca
ctgaccacgaagattcccttcaaggatgtggtggaggcggtcaatcgctctgctttcgtc
aactccgacatgccggtcatcttgtccatcgagaaccactgttcccttccacagcaacga
aagatggctgaaatctttaagaatgttttcggggagcgacttgtgacccgcttccttttt
gagagcgacttcagcgatgatcctcacctgccgtccccgctgcagctgcgcggcaagatc
ctgctcaagaacaagaagctcaaggctcatcaagcaccagtggacatcctcaagcagaag
gcccaccagctggctcatatgcaggcccaggccagcaacgggtcaccgggggtttcttcc
cctcacaaccacaacaacgaggacgaggaggaagaggaagacgaatatgactatgactac
gagtctctatcagatgataacctcctggatgacaaagcagatgccaagaactctgtggac
aaagaggagcttcatgctgacgacatccccaagaggatgaagaagcccgacagcgccgtg
cagagcaaaggaaaggtgttcgacatggagctgggtcaggagttttaccttccgcagaac
aagaaggagagcaggcagattgcccaggagctttcggatttagtgatctactgtcaagct
gtgaagttccctggcctgtccactctgtctccggccggctccagcagagggaaggaccga
gggaagagcaggaagtccatatttagtgcagctccttctcgcagcagcgcagccggggag
gtcacgtcccagagccgcactcctgggaaaggttcttctgagcggctcagctgggaggag
cagcagacgtctccggtcctcaacccccccacgtcgctcagcgccatcatccggactccg
aagtgctaccacatatcgtctgtcaacgagaacgccgccaagcgcctgtgccggcgctac
tcccagaagctcatccagcacacggcctgccagctgctccgcacgtatccggcggccacc
aggatcgactccaccaaccccaaccctctgcagttctggctgcatggaatccagctggtg
gctctcaactaccagactgatgacctgtccatgcagctgaacacagccttgttcgagctc
aacggcggctgtggatacgttctgaagccggccgtgctgtgggaccggacctgtccactt
tatcagcagttctgtccgatggaaagagacacggagaacatgagtcccgccagctactcc
ctcaccgtggtttccggtcagaacgtgtgtccaggcaacagctcgggcagcccctgcatc
gaggtggacgttttggggatgcctgtcgacagccaccatttccgcaccaaacccatccac
cgcaacaccctcaaccccatgtggagcgagcagttccacttcgccgtgcatttcgaggag
ctgtgcttcctgcgattcgccgtggtggagaacaacagctctcagaccacagctcagagg
actctgccactgacggccctgaaaccaggatacaggcacgttcagctgaggacgcaacac
aacgaatccctagaagtgtccagcctttttatctacagccgcaggactgacgaaggccct
atagggggcgcaactccctcatctttgcttttcagctctgaggagagacacctgtcccag
cagcacaaggtcaccgttcacggagctccaggtccggagcccttcgcggttttctgcatc
acagatcagactacagctaaacagctgctggacacggttgtggcgacgacaggaaaccca
tcagcgcacatcttgtgtgaggagaaggttcccctgttgaaggagcgcagtgaggtgaag
cgctgtgctcagtatcgatttctagcacctgaggaggaggtggtcaggctggtcagcagc
tgggacatggaggagggctacgtggggaggatctgcctcaaaacaaaggaggagaacttg
aatgagaaaaacacggagctggagacggaggaggagacaacagcgggatcaaaggacgga
gcagcaggagaggaggatatgttcttcgttcaggtccacgaagtttcaccagagcaacct
cacactgtgatcaaggccccgcggtacagcacggcgcaggacatcatacagcagacgctg
tccaaggcaaagtattcgctgtccaactcaaaccccagcgagtacgtgttggtggaggaa
gtgaccaaggactccgcctcaaagaagtcgtcggccaccaagcccctccagcgggtcctg
ctggaccacgaatgcgtcttccaggctcagagccgctggcggggcgcggggaagttcatt
ctgaaactcaaggatcaggtggtgcgggaagacaaaaagaaagtcatttccttcgccagc
gagctgaagaagctgaccagccgcagccgcagcatgacgacaggcgtgggcgtggacggc
cccggccagagtaaggaggagcgagctgcatgctgtgtggctctgaccgagctccaggag
tga

DBGET integrated database retrieval system