KEGG   Oryzias latipes (Japanese medaka): 101164102Help
Entry
101164102         CDS       T02443                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1-like
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101164102
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101164102
   04070 Phosphatidylinositol signaling system
    101164102
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101164102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 2253 aa AA seqDB search
MATEEHQMQAGPDMLSKRSSPPSIGSRPLRDKALTSSGQEVWRGCDQLWLSKQRSSPSLL
FYRKLSCESVNGVHSAEECVEYSYSSQILSTKEKPLPEPSADKNCEGMKNILGDSESTKP
DRTSSSHVPSDHSTSVYTNSDSKSSPSFCTSCPNKRHIRRGSLPVSMLAFYKTSSHRSFP
GEPSSEPGSLASSPCGSPRLNHRQHPHQGNLKDGFSSLERLNRRPRVQKCPLEKLFLPRS
LAATMTLDSSFPGTISCGRDSSNEEEDEEAPLDEAEFLRNRKDRSTVLVTKSVCAGTIAI
VRTLPSGHISDDVWGIVVDHRCWHPSKKDVWSVLQRGEELRGCRGILHFDKAKLQQVNNY
VKSREECSLIHPANKLLLSWPGCVHLRDPPRPLNVVNNSSARPDLHHRCDPARFYLACGW
RTSLCSLLTGAILEATVAIGARSSLLCPPPQCPNSHAVLKERQLANSMTSSISLPQNVSG
ISKELAELRHLIQFPEEIACILTEQEQQLYQQVLPLDYLCFLTQDLGSPECQIKRHPNLK
ASLSAPNMPTQSPRRSNAVEDLVARFNEVSSWVTWLVLTAGTMEEKREVFSYLVHVAKCC
WNMGNYNGVMEFLAGLRSRKVLKMWQFMDQSDIETIRSLKDAMAQHETSSEYKKVMTRAL
NIPGCKVVPFCGVFLKELSDALDGTASIISLKQSPDNTDDSVEFMSDYSGQHHFMTRSGP
DGLHVPEKEATVSNILQIIRSCNRSLEADDPDDTSSSPSSGTTLAFRSNSLKDRYRNQFT
VGDLSDSDGDLSVEPVIKEVEFQGTEETHKAFSHGTELIPWYVLSLQPDVHQFLLQGATV
IHYDQDSHLTARCLLRLQPDNTTLTWGKPQSGGASPTEQPLGLGQTVMAGLAEGLLDLGV
VKAVFLGHQGVDVQAVCLQNKLSQMTVEENGLSLLYGLSTTDNRLLHFVAPNHTARMLHR
GLSELVNASRKMKRFPDQRLQWLRRQYVSLYQEDGRYEGPTLAQAIELFGGRRWNMGTAG
VEKPGGQKNSPLSINDKSKKKKKVFARGDSGDATDDEMVSRKTRSCKEALNRNGPESESV
DHEDPDDSFPGTLSLSSSKSPGLLASSSSSSSSSSMTGSNHCRPQSSPVLSGTSKSQPGA
WSSRSWHGRGKGCFKSFQNLMISDSTMSFIEFVELFKSFSIRSRKDLKELFDTFAVPCSR
SCSESPPLYTKLRIDDNDTGLQSDLDLLTRNGSDLGLFIRTRQHMSDNQKQISDAIAAAS
IVTNGTGVENASLGVLGLAIPQLNDFLVNCQREHLSYDEILSIIQKFEPSSVMRQMGWMS
FEGFARFLMDKDNSASRNEESQMNPEGLQYPLSYYYIESSHNTYLTGHQLKGESSVELYS
HVLLQGCRSVELDCWDGDDGMPVIYHGHTLTTKIPFKDVVEAVNRSAFVNSDMPVILSIE
NHCSLPQQRKMAEIFKNVFGERLVTRFLFESDFSDDPHLPSPLQLRGKILLKNKKLKAHQ
APVDILKQKAHQLAHMQAQASNGSPGVSSPHNHNNEDEEEEEDEYDYDYESLSDDNLLDD
KADAKNSVDKEELHADDIPKRMKKPDSAVQSKGKVFDMELGQEFYLPQNKKESRQIAQEL
SDLVIYCQAVKFPGLSTLSPAGSSRGKDRGKSRKSIFSAAPSRSSAAGEVTSQSRTPGKG
SSERLSWEEQQTSPVLNPPTSLSAIIRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQ
LLRTYPAATRIDSTNPNPLQFWLHGIQLVALNYQTDDLSMQLNTALFELNGGCGYVLKPA
VLWDRTCPLYQQFCPMERDTENMSPASYSLTVVSGQNVCPGNSSGSPCIEVDVLGMPVDS
HHFRTKPIHRNTLNPMWSEQFHFAVHFEELCFLRFAVVENNSSQTTAQRTLPLTALKPGY
RHVQLRTQHNESLEVSSLFIYSRRTDEGPIGGATPSSLLFSSEERHLSQQHKVTVHGAPG
PEPFAVFCITDQTTAKQLLDTVVATTGNPSAHILCEEKVPLLKERSEVKRCAQYRFLAPE
EEVVRLVSSWDMEEGYVGRICLKTKEENLNEKNTELETEEETTAGSKDGAAGEEDMFFVQ
VHEVSPEQPHTVIKAPRYSTAQDIIQQTLSKAKYSLSNSNPSEYVLVEEVTKDSASKKSS
ATKPLQRVLLDHECVFQAQSRWRGAGKFILKLKDQVALQVVREDKKKVISFASELKKLTS
RSRSMTTGVGVDGPGQSKEERAACCVALTELQE
NT seq 6762 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaagaacatcagatgcaagctggacctgacatgctttcgaagcgttcttcc
cctccttccatagggagcaggcccctcagagataaggcgcttacaagttctggacaggaa
gtatggcgaggctgtgaccagctgtggctctcaaaacagcggagtagcccctccctcctt
ttctacaggaagttgtcatgtgaaagtgtgaatggggttcattctgctgaggagtgtgtg
gagtatagttacagctcgcagattttgagtaccaaagaaaaacctttgccagaaccgtca
gctgataagaactgtgaagggatgaagaacattttgggggattcagagagcaccaaacca
gacagaaccagctcctcccatgtcccgtctgaccattccacaagtgtgtacactaactct
gactctaaatccagtccaagtttctgcacttcttgccccaataaacggcacatccggcgt
ggcagccttcctgtttctatgctagcattctacaagacatcctctcaccgctcctttcct
ggagagccttcaagtgagccgggctctttggcgtcgtctccatgtggctccccccgtctc
aaccaccggcagcatccccatcaaggaaaccttaaagacggattctccagtttggagaga
ctcaaccgaagaccccgcgttcaaaaatgccctttggagaaactgttccttccacggtcc
ttggcggctaccatgaccctcgactcatcctttccaggaaccataagttgcggcagggac
agcagcaatgaagaggaagatgaggaggctcccttggatgaagcagagtttttaagaaac
cgcaaggaccgttctactgttctcgtgaccaaatccgtgtgtgcgggaaccatagcgatc
gtcagaactctgccctcagggcacatttccgacgatgtctgggggattgttgtggatcac
agatgctggcatcccagcaaaaaggacgtgtggtcagtcttacagcgtggagaagaactc
agagggtgtagagggatattacactttgataaagcaaaactgcagcaggtaaacaattat
gtgaagagcagggaggaatgcagcctcatccatcctgccaataaactcctgctgtcttgg
cctggatgtgttcacctcagggatcctcccagaccactgaatgttgtcaacaacagctca
gcgcggcctgatcttcatcatcgctgtgatccagcaagattctaccttgcctgtggttgg
aggacgtcgctgtgttccttgctgacaggagccatcttagaggccaccgtggctatcggt
gcccgctcttctttgctttgtcctccaccccagtgtcccaacagccacgctgtgctgaaa
gagcgtcagctcgccaacagcatgaccagcagtatctctcttcctcaaaatgtcagtggg
atcagtaaggagctagcagagctgcgacacctcatccagttccccgaggagattgcctgt
atcctcactgagcaagagcagcagctttaccagcaggtgttgcccctggactacctctgt
ttcctcacgcaagatctgggcagtcctgaatgccaaattaaacgccacccgaacctgaag
gcgtctctgtcagcacctaacatgccaacccagagtcctcggaggagtaacgctgtggag
gacctggtggctcgcttcaatgaggtgagttcttgggtgacgtggctggtcctgacggcc
ggtaccatggaggagaagagggaagttttttcatacctggtccatgtggccaaatgctgt
tggaacatgggaaactacaacggcgtcatggaattcctggctggactcagatcccgtaag
gttctgaaaatgtggcagttcatggaccagtcagacatcgaaaccataagaagtttaaag
gacgccatggctcagcacgagacatcttctgagtacaagaaggttatgaccagagcgctc
aacatcccgggatgcaaggtggtgcctttttgtggcgtctttctcaaagagctgagcgat
gctttggatggcacagcgagcattatcagcctcaaacaatctccagataacacagacgac
tcagtggagtttatgtcagactacagcggtcagcaccatttcatgacccggtcgggtcca
gacgggctgcatgtgccggagaaagaggcaactgttagcaatatcctgcagatcatcagg
tcttgcaatcgcagtttggaggcagatgatcctgacgacacatccagcagcccttcctct
ggcacaaccctcgcgttcagaagcaactccttgaaggaccgctatcgcaatcaattcaca
gttggggacctgtcggactcggatggcgacttgtcagtggaaccagtcataaaggaggtg
gagtttcaggggactgaggagacccacaaggcgttcagccatggcacagagctcattcca
tggtatgtgttgtcactacaacctgacgttcaccagttcctgctgcagggagccacagtc
attcattatgaccaggacagccacctcacagcccgctgtctgctgcgcctgcaacctgat
aacacaacgctcacctgggggaagcctcaaagcggaggcgcttctccgacagagcagccg
ctggggttagggcagactgtgatggctgggttagcagaaggccttttggacctcggggtt
gtaaaggcggtctttttgggtcatcagggagtcgatgtccaggctgtgtgtttgcaaaac
aagctgagccaaatgacagtggaggagaacggtctttcccttctctatggtctcagtact
actgacaatagacttctgcactttgtggcccccaaccacacagcgcggatgctccataga
ggcctatcagagttggtaaatgcaagcaggaagatgaaaaggtttcccgaccaaagatta
cagtggctgaggaggcagtatgtcagtttgtatcaggaggatggcaggtatgaagggccg
acgttggcccaggccattgagctttttggcggccggcggtggaacatgggtacagccggt
gtggagaaacccggcgggcagaaaaacagcccgctgagcatcaacgacaagtccaagaaa
aagaagaaggtttttgcaaggggggacagtggggatgccaccgatgatgagatggtttcc
aggaagacgcgaagctgtaaagaggccctcaatcggaacggcccagagtctgaaagcgtc
gaccatgaagatccagatgacagctttcctggaacattgtccctctcatccagtaagagc
cctggcttgctagcctcctcttcctcttcatcctcatcctccagcatgacaggatccaac
cactgccgcccacaatcctccccagttctttcaggaacgtccaagtcacagcccggcgct
tggagcagcagatcgtggcacggccgaggtaaaggctgcttcaaaagcttccagaacctc
atgatctctgacagcaccatgagcttcattgaatttgtggaactcttcaagtcattcagt
attcggagcaggaaggacttgaaagagctgtttgacacctttgcagttccctgcagtcgc
tcgtgctcagagtcgcccccactttacaccaaactcaggatagatgacaatgacacgggt
ctacagtcagacctcgaccttttaactcgaaacggttctgatcttggcctgttcatccgc
acgcggcagcacatgtctgacaaccagaagcagatctcagacgccattgcggcagccagc
atcgtaaccaacggcacaggggtggagaacgcatcgttgggggtcttgggattggcgatc
cctcaactcaacgactttctagtgaactgtcagcgagaacacctcagctacgacgagatt
ctcagcatcatacagaaatttgaaccttcttccgttatgaggcagatgggttggatgtca
tttgaaggttttgcaaggttcctgatggacaaagacaactcggcttcccgaaatgaggaa
tcccagatgaatccagaggggctgcagtacccactgtcatactactacattgaatcttct
cataacacgtatctgactggacatcaactcaaaggagagtcttctgttgagctttatagt
cacgtgctgcttcaaggttgtaggagtgtggagctggactgctgggacggagatgacggc
atgccagtaatttaccacggacacacactgaccacgaagattcccttcaaggatgtggtg
gaggcggtcaatcgctctgctttcgtcaactccgacatgccggtcatcttgtccatcgag
aaccactgttcccttccacagcaacgaaagatggctgaaatctttaagaatgttttcggg
gagcgacttgtgacccgcttcctttttgagagcgacttcagcgatgatcctcacctgccg
tccccgctgcagctgcgcggcaagatcctgctcaagaacaagaagctcaaggctcatcaa
gcaccagtggacatcctcaagcagaaggcccaccagctggctcatatgcaggcccaggcc
agcaacgggtcaccgggggtttcttcccctcacaaccacaacaacgaggacgaggaggaa
gaggaagacgaatatgactatgactacgagtctctatcagatgataacctcctggatgac
aaagcagatgccaagaactctgtggacaaagaggagcttcatgctgacgacatccccaag
aggatgaagaagcccgacagcgccgtgcagagcaaaggaaaggtgttcgacatggagctg
ggtcaggagttttaccttccgcagaacaagaaggagagcaggcagattgcccaggagctt
tcggatttagtgatctactgtcaagctgtgaagttccctggcctgtccactctgtctccg
gccggctccagcagagggaaggaccgagggaagagcaggaagtccatatttagtgcagct
ccttctcgcagcagcgcagccggggaggtcacgtcccagagccgcactcctgggaaaggt
tcttctgagcggctcagctgggaggagcagcagacgtctccggtcctcaacccccccacg
tcgctcagcgccatcatccggactccgaagtgctaccacatatcgtctgtcaacgagaac
gccgccaagcgcctgtgccggcgctactcccagaagctcatccagcacacggcctgccag
ctgctccgcacgtatccggcggccaccaggatcgactccaccaaccccaaccctctgcag
ttctggctgcatggaatccagctggtggctctcaactaccagactgatgacctgtccatg
cagctgaacacagccttgttcgagctcaacggcggctgtggatacgttctgaagccggcc
gtgctgtgggaccggacctgtccactttatcagcagttctgtccgatggaaagagacacg
gagaacatgagtcccgccagctactccctcaccgtggtttccggtcagaacgtgtgtcca
ggcaacagctcgggcagcccctgcatcgaggtggacgttttggggatgcctgtcgacagc
caccatttccgcaccaaacccatccaccgcaacaccctcaaccccatgtggagcgagcag
ttccacttcgccgtgcatttcgaggagctgtgcttcctgcgattcgccgtggtggagaac
aacagctctcagaccacagctcagaggactctgccactgacggccctgaaaccaggatac
aggcacgttcagctgaggacgcaacacaacgaatccctagaagtgtccagcctttttatc
tacagccgcaggactgacgaaggccctatagggggcgcaactccctcatctttgcttttc
agctctgaggagagacacctgtcccagcagcacaaggtcaccgttcacggagctccaggt
ccggagcccttcgcggttttctgcatcacagatcagactacagctaaacagctgctggac
acggttgtggcgacgacaggaaacccatcagcgcacatcttgtgtgaggagaaggttccc
ctgttgaaggagcgcagtgaggtgaagcgctgtgctcagtatcgatttctagcacctgag
gaggaggtggtcaggctggtcagcagctgggacatggaggagggctacgtggggaggatc
tgcctcaaaacaaaggaggagaacttgaatgagaaaaacacggagctggagacggaggag
gagacaacagcgggatcaaaggacggagcagcaggagaggaggatatgttcttcgttcag
gtccacgaagtttcaccagagcaacctcacactgtgatcaaggccccgcggtacagcacg
gcgcaggacatcatacagcagacgctgtccaaggcaaagtattcgctgtccaactcaaac
cccagcgagtacgtgttggtggaggaagtgaccaaggactccgcctcaaagaagtcgtcg
gccaccaagcccctccagcgggtcctgctggaccacgaatgcgtcttccaggctcagagc
cgctggcggggcgcggggaagttcattctgaaactcaaggatcaggtagctctccaggtg
gtgcgggaagacaaaaagaaagtcatttccttcgccagcgagctgaagaagctgaccagc
cgcagccgcagcatgacgacaggcgtgggcgtggacggccccggccagagtaaggaggag
cgagctgcatgctgtgtggctctgaccgagctccaggagtga

DBGET integrated database retrieval system