KEGG   Oryzias latipes (Japanese medaka): 101164415Help
Entry
101164415         CDS       T02443                                 

Definition
putative serine/threonine-protein kinase C05D10.2-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101164415
Protein kinases [BR:ola01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   101164415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 603 aa AA seqDB search
MSKKYEAANVSEMEEHIFHKYDIKKRLGKGAYGIVWKGVDRKTGETVAVKKIFDAFRNST
DAQRTFREIMFLQEFGDHPNIVKLINVLRAENDKDIYLIFEYMDTDLHTVIKKGSLLKDI
HKRYVMYQLFKAIKYLHSGNVIHRDQKPSNVLLDTDCVVKLCDFGLARSLNQVQEDSVNP
ALTEYVATRWYRAPEILLGSTRYTKGVDMWSLGCVLGEMLLGKALFPGTSTINQIEKIMS
AIPHPSPDDMFAIKSEYGSSVIQRMLLKPQVPLEDLLPPSVPHDALNLVKSLLVFNPEKR
LTAEQALQHPYVARFHNPAKEPSLNYDVVLPVDDDVQLSVVQYRNKLYEMMLEWKSKNAM
LKLPQAVGCVSSPGKPNAKSERGEKKPVTAKSHRDGDREAKPACKQADQEKHVHLNADVT
NAEAANVKSTLGKTSPITRPGFRKPSYNPITHTVGAPHHDHSTRVSRKQPGQTTNETTAT
LPAEGPNISASMDQILQRGRSAPVAHNHSFSSTLIQTQKNSLVRKEDKSLSAGLHITSTQ
LSSNSRVREAPPPHRPSKKVFQNNCNVLAAGDPRAKLGSYSQAYGTINKTELDSLLRSRP
YHH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaatatgaagcagcaaatgtctcagagatggaggagcacattttccacaaa
tatgacatcaagaagaggctcggtaaaggggcatatgggattgtatggaaaggtgttgac
agaaagacaggggagactgtggcggtgaaaaagatatttgatgccttcagaaacagcaca
gacgcccagagaacgttcagagaaataatgtttcttcaggagtttggagatcaccccaac
atcgtgaaactcataaacgtcctccgtgcagaaaatgacaaagacatttacctcatcttt
gagtatatggatactgacttgcacactgttataaagaaaggctccctcttgaaggacatc
cataagcgttatgtgatgtaccaactcttcaaagccattaaatacctccattcaggaaat
gttattcacagagaccaaaagccttctaatgtgctgctggacactgactgtgtggtcaag
ttgtgtgattttggattggctcgatcactcaaccaggtgcaagaagacagtgtgaatcca
gcactgacagagtacgtggccactcgctggtatcgagctcctgaaatcctgctaggatcc
acaaggtacactaagggagtggacatgtggagccttggctgtgtcctgggagagatgctg
ctggggaaagccctttttcccggaacatccaccatcaaccaaatagagaagatcatgagt
gccatccctcaccccagcccagatgatatgtttgctatcaaatcagaatacgggtcgtct
gtcattcagagaatgctgttaaaaccacaggtgcctttggaggatcttcttccaccgtct
gtgcctcatgatgctctcaacctcgtgaaaagtttactagtttttaacccagagaagcgg
ctgactgcagaacaagccctccagcatccatatgtagccaggtttcacaatccagctaaa
gagcccagtctcaactatgatgttgttctgccagtggatgatgatgtacagttatcagtg
gttcaataccgcaacaaactttatgagatgatgctggagtggaagagcaaaaacgcaatg
ctgaagttgccacaggctgtaggctgtgtcagcagtccggggaagccgaatgccaagagt
gaacgaggagagaagaagccggtgacagcgaaaagccacagagatggtgaccgggaggcg
aaaccagcatgcaagcaggccgaccaggaaaagcatgtgcatttaaacgccgatgttact
aacgctgaagcagcaaacgtcaaatctactttagggaagacaagcccaataactcgccct
ggtttcagaaaaccatcatataatccaatcactcatacagttggtgctcctcatcatgat
cactctactagagtcagcaggaagcaaccgggacaaactactaatgaaaccacagcaaca
ctaccagcagagggacccaatattagtgcatccatggatcagattctgcagcgtggtcgc
tcagcccctgtggcccacaaccactccttctcctccaccctaatccaaacacagaaaaac
tctttagtgcgcaaagaggacaagtctttatctgctggcctgcacatcacatcaacccag
ctaagctcaaactctcgtgttcgtgaggctccgccgccgcaccgtcccagcaaaaaggtc
ttccagaataactgcaatgtgttggctgctggtgacccacgagccaaactcggcagctac
tcccaagcctatggtactatcaacaagacagaacttgacagtctccttcgaagtcggcct
tatcatcattaa

DBGET integrated database retrieval system