KEGG   Oryzias latipes (Japanese medaka): 101164856Help
Entry
101164856         CDS       T02443                                 

Gene name
arg2
Definition
(RefSeq) arginase-2, mitochondrial
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00220  Arginine biosynthesis
ola00330  Arginine and proline metabolism
ola01100  Metabolic pathways
ola01230  Biosynthesis of amino acids
Module
ola_M00029  Urea cycle
ola_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    101164856 (arg2)
   00330 Arginine and proline metabolism
    101164856 (arg2)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     101164856 (arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 101164856
NCBI-ProteinID: XP_004082141
Position
22
AA seq 349 aa AA seqDB search
MALRGPFSRILRSKLGKCSQQTRAESVAVLGAPFCRGQKRGGVEHGPKVIRDAGLVERLS
SLDYSVHDFGDLNFPPVEKDEPYMGVKFPRTVGAANKMLSGAVSRAVGAGHRLVLLGGDH
SLAIGSVSGHARQCPDLCLIWVDAHADINTPMCSPSGNLHGQPVAFMLKELQDKMPSIPG
FSWMKPFLSSRDLVYVGLRDVDRGEHLILKNLGIQYFTMRDIDRLGIQRVMEVALDHLLG
RKQRPIHLSFDIDAFDPSLAPATGTPVNGGLTYREGIYITEEIHNTGLLSAIDMVEVNPT
LGASSEAVEATASLAVDVIASSLGQTREGAHASISVIPAVKSDTEQLCL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagaggaccgttctcccgaatcctcaggtccaaactggggaagtgctcccag
cagaccagagcggagtctgtggcggttctgggagccccgttctgcaggggacagaaaaga
ggaggagtggagcacggacccaaagtcatccgggatgcggggctcgtcgagaggctgtcc
agtttggattactccgtgcacgactttggcgacctcaacttcccccccgtggagaaggac
gagccctacatgggtgtgaagttcccccgaaccgtcggcgcagcaaacaagatgctgtcg
ggggcggtgagcagagccgtgggcgccggacacaggctggtcttgctggggggcgatcac
agcctcgccatcggctcagtgagcggccacgctcgccagtgtcccgacctgtgtctcatc
tgggtcgacgcccacgcagacatcaacacgccgatgtgctcgccatcgggaaacctccac
ggacagcctgtggcgttcatgctcaaagagctgcaagacaagatgcccagtattcccggg
ttctcgtggatgaagcccttcctctcctcgagggacctggtgtacgtgggactgcgggac
gtcgaccgcggagagcacctcattttgaagaatcttggcatccagtacttcaccatgagg
gacatcgacagactgggcatccagagggtcatggaggtcgctctggaccatcttctggga
aggaaacagcgacccatccacctgagctttgacatcgacgcctttgacccgtctctggcc
cccgccacgggaacgccggtgaacggaggcctcacttacagagaaggaatctacatcaca
gaggagatccacaacacaggtctgctgtcggccatcgacatggtggaggtgaaccccacc
ctgggcgccagcagcgaggcagtggaagccaccgcctctttagccgtggacgtcatcgcg
tcgtcgctgggacagacgagggagggcgctcacgcctccatcagcgtgatccccgccgtg
aaaagcgacacggagcagctctgcctatga

DBGET integrated database retrieval system