KEGG   Oryzias latipes (Japanese medaka): 101164975Help
Entry
101164975         CDS       T02443                                 

Definition
protein disulfide-isomerase A3-like
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101164975
Enzymes [BR:ola01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101164975
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101164975
  Exosomal proteins of colorectal cancer cells
   101164975
  Exosomal proteins of bladder cancer cells
   101164975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 493 aa AA seqDB search
MLRLIFLAALAGFTRASDVLEYTDDDFESRIGNHDLALVEFFAPWCGHCKRLAPEYEAAA
TRLKGIVPLVKVDCTANSNICSKYGVSGYPTLKIFRDGEESGPYDGPRSADGIVSFLKKQ
AGPASVELKTDADFEKFIGDQDASVVGFFADQSTSQAEFLKAASALRDDYRFAHTNSEAL
LKSNGIDEEGVVLFRPPRLNNKFEENSVKFTEDKFTSNKIKKFIQENIFGICPHMTDDNK
DQLKGKDLLVAYYEVDYDKNPKGSNYWRNRVMKVAKSFLDQGKKLNFAVANKNTFSHEVS
EFGLSSSSGELPVVAIRTSKGDKYVMTEEFSRDGKALERFLQDYFDGKLKRYLKSEPIPE
DNDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKNLEPKYNELGEKLANDPNVVIA
KMDATANDVPSPYEVSGFPTIYFSPAGRKTSPKKYEGGREVSDFISYLKREASNPLVMQE
EPKKKKKDDKSEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggttgatctttttagccgctctggcaggtttcactcgggccagtgacgtgctc
gagtacacggatgatgactttgaaagcaggattggaaatcatgatctggctctcgtggaa
ttttttgctccttggtgtggtcattgtaaacgactggcccctgaatacgaagcagcagcc
acacgcttgaaaggcattgttccactcgttaaggtcgactgcaccgccaacagcaacata
tgcagcaagtatggcgtcagcgggtacccaactttgaagatcttcagagatggagaggaa
tctggtccttacgatggtcccagaagtgcagatgggatcgtcagttttctgaagaagcag
gctggcccagcttcagtggagctcaagacggatgctgactttgagaagttcatcggagat
caagatgcaagtgttgttgggttcttcgccgatcagagcacttcacaggccgagttcttg
aaggcagccagcgccttgagggacgactatcgctttgcccacaccaactctgaagctctt
cttaagagcaacggcattgatgaagagggagtcgtcctattccgcccgcctcgcctcaac
aacaagttcgaggagaactctgtcaaattcacagaagacaaattcaccagcaacaaaatc
aagaagtttattcaggagaacatctttggaatctgtccacacatgactgacgataacaaa
gatcagttgaaaggaaaagatctgctggtggcttattatgaggtcgattatgacaagaac
cccaaaggttccaactactggaggaatagagtgatgaaggtggcaaaaagcttcctggat
cagggcaagaagcttaacttcgctgtggccaacaagaacacgttcagccacgaagtgtcg
gagttcgggctgagcagcagctcgggggagctccccgtagtggccatccgcacctccaag
ggcgacaaatacgtcatgacggaggagttctcacgtgacggaaaagctctggagcgtttc
ctgcaggactactttgatgggaagctgaaacgctaccttaaatctgagcccattccagag
gacaacgacggccctgttaaggtcttggtggctgagaactttgactccatcgtcaacgac
gacagcaaagatgttctgattgagttctacgccccgtggtgcggacactgcaagaacctg
gagcccaaatacaacgagctgggagaaaagctggccaatgatcccaacgttgtcattgcc
aagatggacgctacagccaatgacgttccatctccgtatgaagtcagcggtttccccacg
atctacttctctccagccggtcgcaagacgtccccaaagaaatatgaaggaggtcgggag
gtcagcgacttcatctcctacctgaagagagaggcctccaacccgttagtgatgcaggaa
gagcccaagaagaagaagaaggatgacaagtcagagctataa

DBGET integrated database retrieval system