KEGG   Oryzias latipes (Japanese medaka): 101164997Help
Entry
101164997         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X4
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04137  Mitophagy - animal
ola04140  Autophagy - animal
ola04141  Protein processing in endoplasmic reticulum
ola04210  Apoptosis
ola04217  Necroptosis
ola04310  Wnt signaling pathway
ola04510  Focal adhesion
ola04530  Tight junction
ola04620  Toll-like receptor signaling pathway
ola04621  NOD-like receptor signaling pathway
ola04622  RIG-I-like receptor signaling pathway
ola04625  C-type lectin receptor signaling pathway
ola04910  Insulin signaling pathway
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04920  Adipocytokine signaling pathway
ola04933  AGE-RAGE signaling pathway in diabetic complications
ola05132  Salmonella infection
ola05168  Herpes simplex infection
Module
ola_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:ola00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101164997
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101164997
   04012 ErbB signaling pathway
    101164997
   04310 Wnt signaling pathway
    101164997
   04068 FoxO signaling pathway
    101164997
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101164997
   04137 Mitophagy - animal
    101164997
  Cell growth and death
   04210 Apoptosis
    101164997
   04217 Necroptosis
    101164997
  Cellular community - eukaryotes
   04510 Focal adhesion
    101164997
   04530 Tight junction
    101164997
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101164997
   04621 NOD-like receptor signaling pathway
    101164997
   04622 RIG-I-like receptor signaling pathway
    101164997
   04625 C-type lectin receptor signaling pathway
    101164997
  Endocrine system
   04910 Insulin signaling pathway
    101164997
   04920 Adipocytokine signaling pathway
    101164997
   04912 GnRH signaling pathway
    101164997
   04914 Progesterone-mediated oocyte maturation
    101164997
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101164997
  Infectious diseases
   05132 Salmonella infection
    101164997
   05168 Herpes simplex infection
    101164997
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101164997
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101164997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 101164997
NCBI-ProteinID: XP_004077448
Position
15
AA seq 438 aa AA seqDB search
MNKNKKDKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDQTLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKYVNHKNIIGLLNVFSPQKSLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVIEQ
LGTPSQDFLMKLNQSVRTYVENRPRYAGYTFEKLFPDVLFPADSDHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPKIPDKHLDEREHTVEEWKDLIYKEV
TEWEEWTKNGVIKGQPPPLGAAVIDSPPQPTSSASSSTNDVSSMSTEPSDPSSDPTMASE
TDSSLNGHTSLSMLACCR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaacaagaaagacaaagagttttacagcgtagatgttggagattccacattc
acggtgctgaagcggtaccagaacttaagaccgatcggctcaggagcgcaaggaatcgtc
tgctctgcgtacgatcaaaccctcgatcgaaatgtcgccataaaaaagctaagtcggcca
tttcaaaaccagactcatgccaagagagcctacagagaactagtcctcatgaagtatgtc
aaccacaaaaatatcatcggcctcctaaatgtattttcaccacaaaagtcattagaggaa
ttccaagatgtgtacttggtgatggagctgatggatgccaacctgtgccaggtcattcag
atggagctggaccacgagcggctgtcctatctgctctatcaaatgctgtgcggcatcaag
cacctccactctgccggcatcattcacagggatctcaagcccagcaatatagtcgtcaaa
tctgattgcactctaaagattttggattttggtttggcccgaacggcagctacaggcctc
ctgatgacgccatatgtggttacacgctactacagagcgccggaagtcatcctgggtatg
ggctaccaagctaatgtggacatatggtctgtgggctgcattctggcagaaatggtgcga
cataaaatcctcttcccaggaagagactacattgaccagtggaacaaggtcattgagcag
ctaggaactccatctcaggactttctgatgaagctcaatcagtcagtaagaacctacgtg
gaaaaccgcccacgatatgccggatacacctttgagaaacttttcccggatgtgctcttc
cctgctgactccgatcacaataagctaaaagccagccaagctagagatctcctatctaag
atgttggtgattgacgcctccaagcgcatttctgtagacgaagccctacagcatccatac
atcaacgtttggtatgatccagcagaagtggaagcacctcctcctaagatcccagacaaa
catctggacgagagggaacacacagtggaagagtggaaagacctcatttataaggaagtt
acggagtgggaggaatggacaaaaaacggagtgataaaaggccagccaccccctttaggt
gcagcagtgatcgacagccccccccagcccacatcctccgcttcctcttcgaccaacgac
gtttcatccatgtccacggagcccagtgaccccagcagtgaccccaccatggcatcagaa
acagacagcagcttgaacggccacacctctctgagcatgctggcctgctgcagataa

DBGET integrated database retrieval system