KEGG   Oryzias latipes (Japanese medaka): 101165316Help
Entry
101165316         CDS       T02443                                 

Definition
histone acetyltransferase KAT6A-like
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101165316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1964 aa AA seqDB search
MVKLANPVYTQWILEAIKKVKKQKQRPSEERICNAVSMSHGLDRKTVLEQLELSVKDGTI
LKVTNKGLNSYKDPDNPGRLVLPKPKGGGSSGGGTAAAGGGGGGVGSSSSSGASHSGKKP
GLDWNKLIKRALEGLHEPGGSSLKNMERFLKCQADVAAYLSGSGSMGPGLFHQQLRVALK
RAVAHGRVAKQGPLFQLISRSGSLDDGTGTVSLESLPPVRLLPHEKDKPVAEPIPICSFC
LGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTARVKALWWQCIECKTCSSCQDQG
KNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICQPRKKGKTLLHEKAAQIKRRYN
APLGRPKSRPGRPFKKLGGRGRRKRSVSANSSSSSSCEGYPGDDRLLFSMRGDDEQSGLR
YNSKTKGLIDALTKFFTPSPEGRKARQEVVDYSQQCRIRKKASRKGEGDDRGDNQDGSDW
REDDDKLPGHENLTEKDIELFRHIQELALQKVGVTGPPDPQMRCPAVIEFGKFEIQTWYS
SPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMKKCSWFHPPANEIYRKDDVSVFEVDGN
VSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDSKGCHLVGYFSKEKHCQQKYNV
SCIMILPQYQRQGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYMAYWRSVVLECLH
ELRDRQISIRQLSKMTGICPQDITSSLHSLGMLEQRGDGLVLVRRDKVVANHMARLKARP
RQLEVDPECLRWTPVIVTNTVVSDADGDDDDEDEEGPEGDSRKDVKPSHNFSSSAWQIQQ
ARTKDEEDEDDEEEERKGFLGFPVSQSSPASPPVRSQAALSDHPRPFLPANGERRPRGRP
PKNWPWGKLNNSPRVGRPSKMRPMDDKDDEDEETTVEGKPSSSSRSPPSLFSLDHQADSP
AFQGLNMARHPSVTPTRRGRPPRKKRGPKPRLADGEGLMPLSVMSRLSDALPVRRSHFSE
SSEEEEDEDEEENRACSPPILTKTAMGLKCKKPLKRPRFRSRSHPQSSVVTETISETTEV
LDEPFVDSDSERPMPRLEEEPSLGHPMRRYPPARSALMLSDPPSKRGRLSNFSDSEEDDF
TPMLKPVASLAAAPSQMANADVPVKKKKGWPKGKSRKPLQWKKQGPEKSPSEAFSHQTSG
DGLGAGGDPEQPKIKMKPGRKPRSWYLQRAQEETERQDKDRQRSLEQHKDDATKRAGRAG
ADGDDKSKDSDDEEDFFSKPAELKVPKRRGRPPKNRGLHQPPLAAPKHSPTSEPDEEEDD
EEDEDAERNWGEDKPSQAPSRPMLSPSSNLGARALKSRPQDADVGDREEDDDEDREEEEE
DCGGGGSGRRAAVAAGAGSRRSEDHDADDEGDGHLEDKSSSGNKKRKSQPSDDDEDDDEE
EDEPASQANSPPVKEEPQAGEAFLDMENSVARDRVSKQEEEEEEEEEEEGEEEAQQPKGQ
PSSADPQQEERRRREQEESAAAAAAVETVTAMSVPSEPLQLHPDDKDITLLMETQHPHQH
ADFKEELGHHHQHHPHHHSNELDLETMQAVRSLTQGEAQEEEGEPQPHHGAYQDCEETLA
ACRTLQSYSHAGEAEEEALSLVEDCGASQHSSPLPNPPVPPLPSQSVRSVNSPALPPGIV
ETTPAGQRGGTPGPTGPSAGSGGGAVGGYTQITPEHPGSLSAPSQQNIETSPMMDVPSVS
DHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGGGTGNGGNGGVMAASVVAGAPS
ASSSSSSSSSSSSSSSAPPSSSAQSNSCSFVQAPSLASSTGNGGPPLGMGSCSLIQQTGP
GPAMKFGPQRENKRPHQEKEVVELYSKAMRVVELTQKFKVNKSTIGTILKKKGLGEGDNQ
DGQRIGQEVALHEGERLPVVWISERQMKAEPTSLELICQKAQVI
NT seq 5895 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactggcaaacccagtgtacacccaatggatcttggaggccatcaaaaaggtg
aagaagcaaaagcagcgtccatcagaggagcggatctgcaatgcggtctccatgtcccac
ggtttggaccgtaaaaccgtcctagagcaactggagctcagcgtcaaggacgggaccatt
cttaaggtcaccaacaagggactgaactcctacaaagacccggataatcccggacgcctg
gttctgccaaagcctaaaggtggaggcagctctggaggagggacagcagcggcaggagga
ggaggtggtggtgtcggcagcagctccagcagcggtgcatctcattcggggaagaagccg
ggtctggactggaacaagcttatcaaacgggcgctggaaggacttcacgagcctggcgga
tccagcctgaagaacatggagcggttcctcaagtgtcaggcggatgtagcggcctacctg
tcgggtagcgggtccatggggcccggcctcttccatcagcagctgagggtcgccctgaag
agggctgtggcccacggacgcgtggccaagcaggggccgctgttccagctgatcagccgc
agcggttccctggacgacggcaccgggacggtttctttggaatcattgccacctgtccgc
ttgctgccacacgagaaagacaagcccgtggcggagcccatccccatctgcagcttctgt
ttgggcaccaaggagcagaaccgggacaagaaaccggaggagctcatctcctgcgccgac
tgcggcaacagcggccacccgtcctgtctgaagttctcaccggagctcacggcgcgagtc
aaggctctgtggtggcagtgcatcgagtgtaagacctgcagcagctgtcaggatcaagga
aagaatgcggacaacatgctcttctgcgactcctgtgaccgcggcttccacatggagtgc
tgcgaccccccactcacgcggatgcctaaaggtatgtggatttgccaaatctgccaaccc
aggaaaaaaggaaagactcttttacacgaaaaggcggcgcagatcaaacggcgctacaac
gcacctctgggccggccaaagtccaggccggggcggcccttcaagaagcttggggggcgc
ggccgcaggaagcggtcggtctcggcgaactcctcctccagctcctcctgtgaggggtac
ccgggcgacgaccggctgctcttctccatgcgaggcgacgacgagcagagcggcctgcgc
tacaacagcaagaccaagggcctcatcgacgccctcaccaagttcttcacgccgtcgccg
gagggccgcaaggcccgccaggaggtggttgactactcgcagcagtgtcgcattcgaaag
aaagcgagtcgcaaaggagaaggggacgacaggggagacaatcaggatggcagcgactgg
cgggaagacgacgacaaactccccggccacgagaacctgacggagaaggatatcgagctg
ttccgacacatccaggagttggcgttacagaaagtgggcgtgacgggtccgcctgaccct
cagatgcgctgcccagccgtcatcgagtttggcaagtttgaaatccagacttggtattca
tctccctacccgcaggaatacagcagacttccaaagctgtacttgtgcgagttctgcctg
cgctacatgaagagtcgcagcatcctctaccagcacatgaagaagtgcagctggttccac
cctcctgccaatgagatctacaggaaagacgacgtctccgtgtttgaggtggacggaaat
gtgagcacaatctactgtcagaacctgtgcctgttggccaagctgttcctggaccacaag
accctgtactacgacgtggagccgttccttttctacgtcctcacgcagaacgacagcaag
ggctgccatcttgtgggctacttctccaaggagaagcactgtcagcagaaatacaatgta
tcatgcatcatgattcttccgcagtaccagcgccagggctatgggcgcttcctcatcgac
ttcagctacttgctgtcgaagcgggaggggcagcccggatctccggagaagcctctgtcc
gacctgggccggctgtcctacatggcctactggcgcagcgttgtgctggagtgtcttcac
gagctgcgggaccgacagatcagcatccggcagcttagcaaaatgacagggatctgcccg
caggacatcacctccagcctgcacagcctgggcatgctggaacagcgaggagacggactt
gtgttggtgcgaagggacaaggttgtggccaaccacatggcccgcttgaaggcgcggcca
cgacagctggaggtggaccctgagtgccttcgctggactccagtcatcgtgacaaacacg
gtggtctctgacgccgacggagacgacgatgatgaggacgaagagggaccagagggggac
agtcgcaaggatgtcaaaccgagccacaacttttcttcgtccgcctggcaaatccagcaa
gcgagaaccaaggacgaggaggatgaagacgatgaggaagaggaaaggaaggggtttttg
gggtttcctgtaagtcaaagctctccggcttcccctcccgtccgctctcaagcagctctg
tccgatcacccgcggccctttctgccagcaaacggagagcgccggccgcgcggccgccca
cccaaaaactggccttggggcaaactgaacaacagcccacgcgtggggcgcccatccaaa
atgcggcccatggacgacaaggacgacgaagacgaggaaaccacggtggaggggaaaccg
tcgtcgagctccaggagccctccatcccttttctccttggaccatcaagcggactctcca
gcctttcagggactcaacatggccaggcacccctccgtaacccccacccggaggggccgc
ccccccagaaaaaagagaggcccaaagcccagactggcagacggggagggtctgatgccg
ctctctgtgatgtcccggttgagcgatgcgctgccggtccgacggagccacttcagtgaa
agtagcgaagaggaggaggatgaagatgaggaggagaacagagcgtgctccccacccatc
ctcacaaagacagccatggggctcaaatgcaagaagcccctgaagaggcctcgttttcgc
agtcgcagccaccctcagagcagcgtggtaacggagaccatctctgaaaccacagaggtg
ttggatgagccctttgtggactctgactctgagcggcccatgccccgactggaagaggag
ccctccctggggcacccgatgcgccgctatccccctgcaagatccgccctgatgttatct
gaccctccttcgaagagaggccgcctttccaacttctccgactcagaggaagatgacttc
acaccaatgctgaagcctgtagcttctctggctgcagctccgtcacaaatggccaacgcg
gatgtcccagtcaagaagaagaagggttggccaaaaggaaagagccgcaaaccgctgcag
tggaagaaacaaggacccgaaaaatcacccagcgaggcgttcagccatcaaacgtctgga
gatggcctcggcgccggcggggaccccgaacagcccaaaatcaaaatgaagccgggtcgc
aaaccccggagctggtacctgcagcgggcgcaggaggagactgagaggcaggacaaggac
agacaaaggtcgcttgagcagcacaaagacgacgcgaccaagcgggccggcagagccggc
gccgacggagacgacaaatcgaaagactctgacgacgaagaggacttcttctccaagccc
gctgagctgaaggtgcctaaaaggcgggggagaccgcccaagaaccgtggccttcaccag
cccccactggctgcccctaaacactccccgacgtccgaaccagacgaagaagaggatgat
gaagaagatgaagatgctgagaggaattggggagaagacaaacccagtcaagctccgtcc
cgccccatgctctccccctcttcaaatttgggagcacgcgctctgaagtcacgacctcag
gatgctgatgtgggtgacagggaggaagacgatgacgaggacagggaggaggaggaggaa
gattgcggaggtggaggaagcggcaggcgggcggcggtcgcagcaggagcaggaagcagg
cggagcgaagaccacgacgctgatgatgaaggagatggacacttagaagacaagagcagc
agtggcaacaagaagaggaaaagtcaaccttcggacgatgacgaagacgacgacgaagag
gaggatgagcccgcctcacaagcgaactcgcctccggtgaaagaggaaccacaagcaggc
gaggcttttttagacatggagaacagcgtggcccgggaccgcgtcagcaagcaggaggag
gaggaggaggaggaggaggaggaagaaggggaggaggaagcgcagcagcccaaaggtcaa
ccctcctcagctgatcctcagcaggaagagaggcggcgccgggagcaggaggagtcggct
gcagccgccgctgcagtggagacggtcacagccatgtctgttccctctgagcctctgcag
ctgcacccggacgacaaggacatcacgctgttgatggagacccagcacccccaccagcac
gccgacttcaaagaggagctgggccaccatcaccaacaccacccgcaccaccactccaac
gagctggatctggagaccatgcaggctgtgcggtccctgacccaaggggaggctcaggag
gaagagggcgagccgcagccccaccacggcgcttaccaagactgcgaggagacgctggcc
gcctgccgcacgctgcagagctacagccacgcgggggaggcagaggaggaggccttgtct
ttggtggaggactgtggggcgtcgcagcacagcagccccctccccaacccaccggtgccc
cccctgcccagtcagtctgttcgctcagtcaacagcccggcgctgccccccggcatcgtg
gaaacgactcctgctgggcagcgaggaggaacgccgggccccacaggccccagcgccggt
agcggcggcggtgccgtaggtggctacacccagatcacgcctgaacatcctggctctctg
tcggccccctcccagcagaacatagagacttctcccatgatggacgtgccgtctgtttcg
gaccactcccagcaggtggtggacagcggcttcagcgacctgggcagcatagaaagcact
acagagaactacgacaaccccagcagctacgactccaccatgggcggagggggcggcgga
acaggcaacggggggaacggaggggtaatggcggcttccgtagtcgcaggtgctccctcg
gcttcgtcctcgtcctcgtcctcgtcctcgtcctcttcctccagttccgcccctccgtcc
tcttctgctcagtccaacagctgctcattcgtccaagcgcccagtctggcgtcttccaca
ggaaacggggggcccccgctcggcatgggcagctgcagccttatccagcagactggaccg
ggccccgctatgaagtttggtccccaaagggaaaataaaaggccccaccaagagaaagaa
gtagttgaactgtacagcaaagccatgcgagtggtggagctcacacagaagtttaaggtg
aacaagtccaccattgggacaatcctaaaaaaaaaaggtttgggcgaaggggataaccag
gatggacagcgaattggtcaggaagtcgctctgcatgagggggaacggctccccgtggtt
tggatcagtgagaggcagatgaaggcggagccaacgagcctggagctcatctgccagaag
gcccaggtcatttaa

DBGET integrated database retrieval system