KEGG   Oryzias latipes (Japanese medaka): 101165316Help
Entry
101165316         CDS       T02443                                 

Definition
(RefSeq) histone acetyltransferase KAT6A isoform X1
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101165316
Chromosome [BR:ola03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101165316
   HAT complexes
    MOZ/MORF complex
     101165316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
9
AA seq 2246 aa AA seqDB search
MVKLANPVYTQWILEAIKKVKKQKQRPSEERICNAVSMSHGLDRKTVLEQLELSVKDGTI
LKVTNKGLNSYKDPDNPGRLVLPKPKGGGSSGGGSAAASSAAAPAAAAGGGGGGVGSSSS
SGASHSGKKPGLDWNKLIKRALEGLHEPGGSSLKNMERFLKCQADVAAYLSGSGSMGPGL
FHQQLRVALKRAVAHGRVAKQGPLFQLISRSGSLDDGTGTVSLESLPPVRLLPHEKDKPV
AEPIPICSFCLGTKEQNRDKKPEELISCADCGNSGHPSCLKFSPELTARVKALWWQCIEC
KTCSSCQDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICQPRKKGKTLLHE
KAAQIKRRYNAPLGRPKSRPGRPFKKLGGRGRRKRSVSANSSSSSSCEGYPGDDRLLFSM
RGDDEQSGLRYNSKTKGLIDALTKFFTPSPEGRKARQEVVDYSQQCRIRKKASRKGEGDD
RGGEDNQDGSDWREDDDKLPGHENLTEKDIELFRHIQELALQKVGVTGPPDPQMRCPAVI
EFGKFEIQTWYSSPYPQEYSRLPKLYLCEFCLRYMKSRSILYQHMKKCSWFHPPANEIYR
KDDVSVFEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDSKGCHLVGYF
SKEKHCQQKYNVSCIMILPQYQRQGYGRFLIDFSYLLSKREGQPGSPEKPLSDLGRLSYM
AYWRSVVLECLHELRDRQISIRQLSKMTGICPQDITSSLHSLGMLEQRGDGLVLVRRDKV
VANHMARLKARPRQLEVDPECLRWTPVIVTNTVVSDADGDDDDEDEEGPEGDSRKDVKPS
HNFSSSAWQIQQARTKDEEDEDDEEEERKGFLGFPVSQSSPASPPVRSQAALSDHPRPFL
PANGERRPRGRPPKNWPWGKLNNSPRVGRPSKMRPMDDKDDEDEETTVEGKPSSSSRSPP
SLFSLDHQADSPAFQGLNMARHPSVTPTRRGRPPRKKRGPKPRLADGEGLMPLSVMSRLS
DALPVRRSHFSESSEEEEDEDEEENRACSPPILTKTAMGLKCKKPLKRPRFRSRSHPQSS
VVTETISETTEVLDEPFVDSDSERPMPRLEEEPSLGHPMRRYPPARSALMLSDPPSKRGR
LSNFSDSEEDDFTPMLKPVASLAAAPSQMANADVPVKKKKGWPKGKSRKPLQWKKQGPEK
SPSEAFSHQTSGDGLGAGGDPEQPKIKMKPGRKPRSWYLQRAQEETERQDKDRQRSLEQH
KDDATKRAGRAGADGDDKSKDSDDEEDFFSKPAELKVPKRRGRPPKNRGLHQPPLAAPKH
SPTSEPDEEEDDEEDEDAERNWGEDKPSQAPSRPMLSPSSNLGARALKSRPQDADVGDRE
EDDDEDREEEEEDCGGGGSGRRAAVAAGAGSRRSEDHDADDEGDGHLEDKSSSGNKKRKS
QPSDDDEDDDEEEDEPASQANSPPVKEEPQAGEAFLDMENSVARDRVSKQEEEEEEEEEE
EGEEEAQQPKGQPSSADPQQEERRRREQEESAAAAAAVETVTAMSVPSEPLQLHPDDKDI
TLLMETQHPHQHADFKEELGHHHQHHPHHHSNELDLETMQAVRSLTQGEAQEEEGEPQPH
HGAYQDCEETLAACRTLQSYSHAGEAEEEALSLVEDCGASQHSSPLPNPPVPPLPSQSVR
SVNSPALPPGIVETTPAGQRGGTPGPTGPSAGSGGGAVGGYTQITPEHPGSLSAPSQQNI
ETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYDNPSSYDSTMGGGGGGTGNGGNGG
VMAASVVAGAPSASSSSSSSSSSSSSSSAPPSSSAQSNSCSFVQAPSLASSTGNGGPPLG
MGSCSLIQQTGPGPASGPGSNNIVPQPPPPPPPSNTPNCGIKSPQSCGVIERPPSTNQQP
QAQKKVPQPPPQQQAPNPQPPPSAPPPPQQQALSQCSMGNGFATTPMIMEIPDSGGGAGS
RPLYERMGQDFGSGGYPQPSSFSLAKLQQLTNTIMDPHAMPYSHSASVTSYATSVSLSNP
GLAPSPHTPLPQGQPTMTSPPNLSSGTMNLSSLQLQCSMPTTNISLGPPHTQRLQGQMTT
VKGHISIRSKAAQQLAPAPHQQQLYSRSSGAVAMQGTPRTLAVQRSMMPNLMPTPAPYNS
MNMAPLNAMSAGYRMPQPMMNSSYHSNPAYMNQPAQYPMQMQMGMMGGQGYPQQPMQPNH
HGNMMYAGPSHHSYAGVPKQSPYMSR
NT seq 6741 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaactggcaaacccagtgtacacccaatggatcttggaggccatcaaaaaggtg
aagaagcaaaagcagcgtccatcagaggagcggatctgcaatgcggtctccatgtcccac
ggtttggaccgtaaaaccgtcctagagcaactggagctcagcgtcaaggacgggaccatt
cttaaggtcaccaacaagggactgaactcctacaaagacccggataatcccggacgcctg
gttctgccaaagcctaaaggtggaggcagctctggaggagggagtgctgcggcatcgtca
gcggcggcaccagcagcagcggcaggaggaggaggtggtggtgtcggcagcagctccagc
agcggtgcatctcattcggggaagaagccgggtctggactggaacaagcttatcaaacgg
gcgctggaaggacttcacgagcctggcggatccagcctgaagaacatggagcggttcctc
aagtgtcaggcggatgtagcggcctacctgtcgggtagcgggtccatggggcccggcctc
ttccatcagcagctgagggtcgccctgaagagggctgtggcccacggacgcgtggccaag
caggggccgctgttccagctgatcagccgcagcggttccctggacgacggcaccgggacg
gtttctttggaatcattgccacctgtccgcttgctgccacacgagaaagacaagcccgtg
gcggagcccatccccatctgcagcttctgtttgggcaccaaggagcagaaccgggacaag
aaaccggaggagctcatctcctgcgccgactgcggcaacagcggccacccgtcctgtctg
aagttctcaccggagctcacggcgcgagtcaaggctctgtggtggcagtgcatcgagtgt
aagacctgcagcagctgtcaggatcaaggaaagaatgcggacaacatgctcttctgcgac
tcctgtgaccgcggcttccacatggagtgctgcgaccccccactcacgcggatgcctaaa
ggtatgtggatttgccaaatctgccaacccaggaaaaaaggaaagactcttttacacgaa
aaggcggcgcagatcaaacggcgctacaacgcacctctgggccggccaaagtccaggccg
gggcggcccttcaagaagcttggggggcgcggccgcaggaagcggtcggtctcggcgaac
tcctcctccagctcctcctgtgaggggtacccgggcgacgaccggctgctcttctccatg
cgaggcgacgacgagcagagcggcctgcgctacaacagcaagaccaagggcctcatcgac
gccctcaccaagttcttcacgccgtcgccggagggccgcaaggcccgccaggaggtggtt
gactactcgcagcagtgtcgcattcgaaagaaagcgagtcgcaaaggagaaggggacgac
aggggaggtgaggacaatcaggatggcagcgactggcgggaagacgacgacaaactcccc
ggccacgagaacctgacggagaaggatatcgagctgttccgacacatccaggagttggcg
ttacagaaagtgggcgtgacgggtccgcctgaccctcagatgcgctgcccagccgtcatc
gagtttggcaagtttgaaatccagacttggtattcatctccctacccgcaggaatacagc
agacttccaaagctgtacttgtgcgagttctgcctgcgctacatgaagagtcgcagcatc
ctctaccagcacatgaagaagtgcagctggttccaccctcctgccaatgagatctacagg
aaagacgacgtctccgtgtttgaggtggacggaaatgtgagcacaatctactgtcagaac
ctgtgcctgttggccaagctgttcctggaccacaagaccctgtactacgacgtggagccg
ttccttttctacgtcctcacgcagaacgacagcaagggctgccatcttgtgggctacttc
tccaaggagaagcactgtcagcagaaatacaatgtatcatgcatcatgattcttccgcag
taccagcgccagggctatgggcgcttcctcatcgacttcagctacttgctgtcgaagcgg
gaggggcagcccggatctccggagaagcctctgtccgacctgggccggctgtcctacatg
gcctactggcgcagcgttgtgctggagtgtcttcacgagctgcgggaccgacagatcagc
atccggcagcttagcaaaatgacagggatctgcccgcaggacatcacctccagcctgcac
agcctgggcatgctggaacagcgaggagacggacttgtgttggtgcgaagggacaaggtt
gtggccaaccacatggcccgcttgaaggcgcggccacgacagctggaggtggaccctgag
tgccttcgctggactccagtcatcgtgacaaacacggtggtctctgacgccgacggagac
gacgatgatgaggacgaagagggaccagagggggacagtcgcaaggatgtcaaaccgagc
cacaacttttcttcgtccgcctggcaaatccagcaagcgagaaccaaggacgaggaggat
gaagacgatgaggaagaggaaaggaaggggtttttggggtttcctgtaagtcaaagctct
ccggcttcccctcccgtccgctctcaagcagctctgtccgatcacccgcggccctttctg
ccagcaaacggagagcgccggccgcgcggccgcccacccaaaaactggccttggggcaaa
ctgaacaacagcccacgcgtggggcgcccatccaaaatgcggcccatggacgacaaggac
gacgaagacgaggaaaccacggtggaggggaaaccgtcgtcgagctccaggagccctcca
tcccttttctccttggaccatcaagcggactctccagcctttcagggactcaacatggcc
aggcacccctccgtaacccccacccggaggggccgcccccccagaaaaaagagaggccca
aagcccagactggcagacggggagggtctgatgccgctctctgtgatgtcccggttgagc
gatgcgctgccggtccgacggagccacttcagtgaaagtagcgaagaggaggaggatgaa
gatgaggaggagaacagagcgtgctccccacccatcctcacaaagacagccatggggctc
aaatgcaagaagcccctgaagaggcctcgttttcgcagtcgcagccaccctcagagcagc
gtggtaacggagaccatctctgaaaccacagaggtgttggatgagccctttgtggactct
gactctgagcggcccatgccccgactggaagaggagccctccctggggcacccgatgcgc
cgctatccccctgcaagatccgccctgatgttatctgaccctccttcgaagagaggccgc
ctttccaacttctccgactcagaggaagatgacttcacaccaatgctgaagcctgtagct
tctctggctgcagctccgtcacaaatggccaacgcggatgtcccagtcaagaagaagaag
ggttggccaaaaggaaagagccgcaaaccgctgcagtggaagaaacaaggacccgaaaaa
tcacccagcgaggcgttcagccatcaaacgtctggagatggcctcggcgccggcggggac
cccgaacagcccaaaatcaaaatgaagccgggtcgcaaaccccggagctggtacctgcag
cgggcgcaggaggagactgagaggcaggacaaggacagacaaaggtcgcttgagcagcac
aaagacgacgcgaccaagcgggccggcagagccggcgccgacggagacgacaaatcgaaa
gactctgacgacgaagaggacttcttctccaagcccgctgagctgaaggtgcctaaaagg
cgggggagaccgcccaagaaccgtggccttcaccagcccccactggctgcccctaaacac
tccccgacgtccgaaccagacgaagaagaggatgatgaagaagatgaagatgctgagagg
aattggggagaagacaaacccagtcaagctccgtcccgccccatgctctccccctcttca
aatttgggagcacgcgctctgaagtcacgacctcaggatgctgatgtgggtgacagggag
gaagacgatgacgaggacagggaggaggaggaggaagattgcggaggtggaggaagcggc
aggcgggcggcggtcgcagcaggagcaggaagcaggcggagcgaagaccacgacgctgat
gatgaaggagatggacacttagaagacaagagcagcagtggcaacaagaagaggaaaagt
caaccttcggacgatgacgaagacgacgacgaagaggaggatgagcccgcctcacaagcg
aactcgcctccggtgaaagaggaaccacaagcaggcgaggcttttttagacatggagaac
agcgtggcccgggaccgcgtcagcaagcaggaggaggaggaggaggaggaggaggaggaa
gaaggggaggaggaagcgcagcagcccaaaggtcaaccctcctcagctgatcctcagcag
gaagagaggcggcgccgggagcaggaggagtcggctgcagccgccgctgcagtggagacg
gtcacagccatgtctgttccctctgagcctctgcagctgcacccggacgacaaggacatc
acgctgttgatggagacccagcacccccaccagcacgccgacttcaaagaggagctgggc
caccatcaccaacaccacccgcaccaccactccaacgagctggatctggagaccatgcag
gctgtgcggtccctgacccaaggggaggctcaggaggaagagggcgagccgcagccccac
cacggcgcttaccaagactgcgaggagacgctggccgcctgccgcacgctgcagagctac
agccacgcgggggaggcagaggaggaggccttgtctttggtggaggactgtggggcgtcg
cagcacagcagccccctccccaacccaccggtgccccccctgcccagtcagtctgttcgc
tcagtcaacagcccggcgctgccccccggcatcgtggaaacgactcctgctgggcagcga
ggaggaacgccgggccccacaggccccagcgccggtagcggcggcggtgccgtaggtggc
tacacccagatcacgcctgaacatcctggctctctgtcggccccctcccagcagaacata
gagacttctcccatgatggacgtgccgtctgtttcggaccactcccagcaggtggtggac
agcggcttcagcgacctgggcagcatagaaagcactacagagaactacgacaaccccagc
agctacgactccaccatgggcggagggggcggcggaacaggcaacggggggaacggaggg
gtaatggcggcttccgtagtcgcaggtgctccctcggcttcgtcctcgtcctcgtcctcg
tcctcgtcctcttcctccagttccgcccctccgtcctcttctgctcagtccaacagctgc
tcattcgtccaagcgcccagtctggcgtcttccacaggaaacggggggcccccgctcggc
atgggcagctgcagccttatccagcagactggaccgggccccgctagtggaccgggcagc
aacaacatagtgccccagccgccgccacccccaccaccctccaatacgccaaactgtgga
atcaagtccccgcagagctgtggcgtgattgagagaccccccagcaccaaccagcagccg
caggcacaaaaaaaggtccctcaaccgcctcctcagcagcaagcccccaaccctcaaccc
ccaccctcagctcccccaccaccacagcaacaggctctgtcccagtgcagcatgggaaac
ggtttcgccaccacacccatgatcatggagattccagacagtggaggcggggcagggagc
cgccccctctatgagcgcatggggcaggactttggatctgggggctacccgcagccctcc
tccttcagcctggccaaactccaacagctcaccaacaccatcatggacccccacgccatg
ccctactctcactccgcctctgtcacctcttacgccaccagtgtttccctgtccaaccca
ggcctggccccctcaccccacacccctctcccccaagggcagcccactatgacctcaccc
cccaacctgagctctggcaccatgaacctgagctctctgcagctgcaatgcagcatgcca
accaccaacatcagcctgggacccccccacacgcagcggctgcagggtcagatgaccacc
gtcaaaggccacatttcaatccgctcgaaagccgctcagcagctggcccccgccccccac
cagcagcagctctacagccgcagctccggagccgtggccatgcagggtacgccgcgcacg
ttggcggtgcagcgtagcatgatgcccaacctcatgcctactccggcgccgtacaactcc
atgaacatggcgcccctgaacgccatgtcagctggctacaggatgccgcagcccatgatg
aacagcagttaccacagcaaccccgcctatatgaaccagccggcccagtaccccatgcag
atgcagatgggcatgatgggaggacagggctacccccagcagcctatgcagcccaatcac
cacggcaacatgatgtacgctggcccctcccaccacagctatgccggagtcccgaaacag
tcaccgtacatgagcagatga

DBGET integrated database retrieval system