KEGG   Oryzias latipes (Japanese medaka): 101165450Help
Entry
101165450         CDS       T02443                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101165450
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101165450
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101165450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 932 aa AA seqDB search
MVKTAYQCCALPNAYLTPKEQIIAAKTLISSNHDIKDDCSIFDGFIEEDEKDKAKRESRN
KSEKKRRDQFNVLIKELGTMLPGNTRKMDKSTILQKSIDFLCKHKEIAAQSESSEIRQDW
KPPFLSNEEFTQLMLEALDGFFIAIMTDGNILYVSESVTSLLEHLPADLVDQNLLNFLPV
GEHSEVYKALSTHPADLESLNTDYMKSKNHMEFCCHVLRGAIDPKEPSVYEYVKFIGNFK
SLNNVPNMTRNGLAGVLQRSLQPAFDDQVCFVATVRLAKPQFIKEMCTIEEPNEEFTSRH
SMEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHVDDLEMLAKCHEHLLQYGKGKSCYYR
FLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAEQRRELGIEESNPEANA
DKNQDSGSESQLNTSSLKEALERFESRTPSTSSRSSRKSSSHVSDNTCTSTAPKLHMDTA
TPPRQSLASTMEMTPQRCSSISSQSMSSQTTGQSANPSMMSQQQQQQQQQQQQQQQTQQL
QTNVQPAMEFTAQVNAMQHLKEQLEQRTRMIQANIQRQQEELRHIQEQLQRVQGQGIQML
QQQQGGTVNVPLSQAGAVPQTAPLAGQVQQTPVNSVQSGTLQLTIQQQPSQHQQSIQQQT
NTAAQPQRQSQQSSQAQSQNQGSVPAPLYSAMMISQPGQPNVLQISTSLAQNNTQQGAAV
ATFTQDRQIRFPAGQQLVTKLVTAPMHACSAVMVPSMFMGPVVTPYNPFGGQQQGGQTQT
LTLQPAQQPQGQPDSQNQTSVVTQNNQQGQQQQQQFLQGTHLLHSNQSAQLILRAAFPLH
QQGTFTQATLPQQQQPVQQQQQQPVQQQQQQQQQQQQRQHQQQQQQQQRHQQQRQQQPQS
HHQRHQHQLKPQPQKQPKSSSLHRPDTVNNQQ
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaacagcctaccagtgctgtgctcttccaaatgcctacctcacgcctaaagaa
cagattattgcagcaaaaaccctgatcagcagcaaccatgacatcaaagatgattgcagc
atctttgatgggtttatagaagaagatgagaaggacaaggcaaaacgcgagtcccgtaat
aaatctgagaagaaacgaagagaccagttcaatgtcctcatcaaggaacttggcacgatg
ttgccaggcaacaccagaaagatggacaagtccaccattctgcaaaaaagtatcgacttc
ctgtgtaaacacaaagagattgcagcccagtcggaatcaagcgagatcagacaggactgg
aaacctccttttctcagcaacgaggaattcacgcaacttatgctggaggctttggacggt
ttcttcatagcaataatgactgacgggaacattctctacgtctctgagagtgttacatca
ttgctcgaacacctgccagccgacttggtggaccagaaccttttaaacttcttgccggtt
ggagaacactccgaagtgtacaaggctctgtccacacaccccgctgaccttgagagcctc
aatacggattacatgaagagtaaaaatcatatggagttctgctgtcatgtgctgcgaggg
gccatcgaccccaaagaaccttcagtctacgaatacgtaaagttcattggcaacttcaag
tctctcaacaatgttccaaatatgacgaggaatggcttggcgggggtgctgcagagatcg
ctacagcccgcttttgatgaccaggtgtgctttgttgcaacggttcgattggccaaacct
cagtttatcaaggaaatgtgtaccatagaagaacccaatgaagaattcacctcaagacac
agcatggaatggaaattccttttcttagaccacagggctccgcccatcataggctatcta
ccatttgaggttcttggaacatcggggtatgactattatcatgtggatgacttggagatg
ctagctaaatgccatgaacacttattgcagtatgggaaaggaaagtcatgctactaccgt
tttctaacaaaaggtcaacagtggatctggctccaaacccattactacatcacttatcat
cagtggaactctcgcccagagtttatcgtctgtacacacacagtagtcagctatgcagag
gtaagggctgagcagcgcagagagctgggcattgaagagtctaatccagaggccaatgct
gacaagaaccaggattctggctcagagtctcaacttaacacctccagcttgaaggaagct
ctggagcggtttgaaagccgaacaccttcaacatcgtcacggagctcccgcaagtcctcc
tcgcacgtctctgacaacacctgcacttccacagctccaaagctacacatggacacagcc
acgcctcctcggcagtcattagcctccaccatggagatgactccccagcggtgctcatcg
atcagcagtcagtctatgagctctcagacaacaggccagagtgcaaacccgagcatgatg
tctcagcagcagcagcagcagcagcagcagcagcaacaacaacaacaaacacaacaactt
cagacaaatgtacagcctgccatggagtttacagcgcaggttaacgccatgcagcacctt
aaggagcagctggagcagaggaccagaatgatccaggcgaacatccagcggcagcaggaa
gagctccggcacatccaagagcagctccagagagtccaagggcagggcatacagatgtta
cagcagcagcagggcggaacggtaaatgtaccgctctctcaggcaggggcagtcccgcag
acggctcctttggctggtcaggtgcagcaaaccccagtaaactccgtccaatcaggaact
cttcagctcaccattcagcagcagccgtctcagcatcaacaaagcatacagcagcagacc
aacacggcggcacagcctcagcgacagtcccagcagtcttcacaggcccagtcacagaac
caaggctcagtacctgctcccctgtacagcgccatgatgatctcccagccagggcagcca
aacgtgctgcagatcagcaccagcctagctcaaaacaacacgcagcaaggcgcagctgta
gccaccttcacacaggaccgtcagattagattccctgcagggcagcagctggtgaccaag
ctggtgaccgctccaatgcatgcatgcagtgcagttatggtgccgtctatgttcatggga
ccggttgtaactccttacaacccctttggtgggcagcagcaggggggccagacccaaacc
ctgactcttcaacctgcccaacaaccccaaggtcagcctgacagccaaaaccaaacctct
gtagtgacacagaacaaccagcaggggcagcaacaacaacagcaattcctgcagggcacc
catcttctccacagtaaccagtctgcacagctgatcctgcgggcagctttcccactccac
caacaaggaactttcacccaggccacacttcctcagcagcaacagccagtgcagcaacag
cagcaacagccagtgcagcagcagcagcagcaacaacaacaacagcagcaaaggcaacac
caacaacaacagcagcaacagcaaaggcaccaacagcaaaggcagcaacaaccgcaatct
caccaccagaggcaccagcatcagctgaaaccacagcctcagaaacagccgaaatcctcc
tcattgcacaggcctgacaccgtcaacaaccagcagtga

DBGET integrated database retrieval system