KEGG   Oryzias latipes (Japanese medaka): 101165599Help
Entry
101165599         CDS       T02443                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101165599
Enzymes [BR:ola01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     101165599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 261 aa AA seqDB search
MHVLLLKEPREEASGPDPYLKELASHGHKATLIPVLSFKFVSLNTLADKLFQPEKHGGLI
FTSPRAVEAVKMCLDAEKRKEEWNKSLRDQWNTKPIYVVGKATAALVQNLGLTPLGEDTG
TAEVLSRVIIEREDTNIPPFLFPCGSIKREVLPTALREKGVPLETLTVYQTSEHPDLERN
LNNFFTEQGTPACVAFFSPSGVKFCLELILRLSGDQRTQIKFAAIGPTTRDAMAAEGLCV
SCTAEKPTAEHLAAEISKALM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgttgcttctgaaagagcccagagaagaagcttctggacctgatccatatctt
aaggagctggcatcacatggacacaaagctacactaattccagtgctgtcatttaaattt
gtctcattaaacacattggctgataagctttttcagccagaaaaacatggaggccttata
tttactagccccagggcagtggaggctgtgaaaatgtgcttagacgcagaaaaaagaaaa
gaagagtggaacaagtctctgagagatcagtggaacaccaaacccatctatgtggttgga
aaggccaccgctgcattagtccagaatctgggtctgacccctttaggagaagacacagga
acagcagaggtcctatcacgtgtcatcattgaaagagaggacacaaacattcctccgttc
ttgttcccgtgcggctcgatcaaaagagaagttttgcccacggctttgagggaaaaggga
gttcccctggagacactgactgtctatcaaacctccgaacatcccgatctggaaagaaat
ctgaacaatttcttcacagagcaggggactccagcatgcgttgcttttttcagtccgtca
ggagtaaagttttgtctggaattaatattgaggctatcaggcgatcagcggactcaaata
aagtttgcagccatagggcctaccacgagagatgcaatggctgccgagggtctttgtgtg
agctgcactgcagagaagccgacagccgaacaccttgcagcggagatatccaaggctctg
atgtga

DBGET integrated database retrieval system