KEGG   Oryzias latipes (Japanese medaka): 101165599Help
Entry
101165599         CDS       T02443                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ola00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 261 aa AA seqDB search
MHVLLLKEPREEASGPDPYLKELASHGHKATLIPVLSFKFVSLNTLADKLFQPEKHGGLI
FTSPRAVEAVKMCLDAEKRKEEWNKSLRDQWNTKPIYVVGKATAALVQNLGLTPLGEDTG
TAEVLSRVIIEREDTNIPPFLFPCGSIKREVLPTALREKGVPLETLTVYQTSEHPDLERN
LNNFFTEQGTPACVAFFSPSGVKFCLELILRLSGDQRTQIKFAAIGPTTRDAMAAEGLCV
SCTAEKPTAEHLAAEISKALM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgttgcttctgaaagagcccagagaagaagcttctggacctgatccatatctt
aaggagctggcatcacatggacacaaagctacactaattccagtgctgtcatttaaattt
gtctcattaaacacattggctgataagctttttcagccagaaaaacatggaggccttata
tttactagccccagggcagtggaggctgtgaaaatgtgcttagacgcagaaaaaagaaaa
gaagagtggaacaagtctctgagagatcagtggaacaccaaacccatctatgtggttgga
aaggccaccgctgcattagtccagaatctgggtctgacccctttaggagaagacacagga
acagcagaggtcctatcacgtgtcatcattgaaagagaggacacaaacattcctccgttc
ttgttcccgtgcggctcgatcaaaagagaagttttgcccacggctttgagggaaaaggga
gttcccctggagacactgactgtctatcaaacctccgaacatcccgatctggaaagaaat
ctgaacaatttcttcacagagcaggggactccagcatgcgttgcttttttcagtccgtca
ggagtaaagttttgtctggaattaatattgaggctatcaggcgatcagcggactcaaata
aagtttgcagccatagggcctaccacgagagatgcaatggctgccgagggtctttgtgtg
agctgcactgcagagaagccgacagccgaacaccttgcagcggagatatccaaggctctg
atgtga

DBGET integrated database retrieval system