KEGG   Oryzias latipes (Japanese medaka): 101165809Help
Entry
101165809         CDS       T02443                                 

Definition
histone acetyltransferase KAT7-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101165809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 649 aa AA seqDB search
MPRRKRTAGSSSDGTEDSDFSADLEHADASDNGRRRSSARLTRSSLRLSQSSQDDGPDVS
ADSAAPASVFSSGRRITRSQQGASSTTAKKYPLRQSRSSGSDTEAIASFDHTDGKHGADR
DETPPRTPTGNASSSESDLEVSSSNNETDERLAKELSLKEAAAHDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGRHERHFSISGCPLYHNLSADECKGKASTRDKLAEERTLSHRH
DENRHSTRNQAPSDRQLRYKEKVTDLRRKRDSGLNKEQKDKYMEHRQSHGTSREPLLENI
TSDYDLELFRKAQARASDDLVREKIHPHLHLFCPLSLCVIPPCASFSLFQSADAPPQPQE
ASQTLIFGSSDSLCEPXXXXXXXXXLDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTIL
RRHMAKCVWKHPPGDEIYRKTNISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPF
LFYVMAEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVE
EKVGSPERPLSDLGLISYRSYWKDVLLRYMNNFQGKEISIKEISQETAVNPVDIVSTLQA
LQMLKYWKGKHLVLKRQDLIDDWKAKETKRGNGKTIDPTALKWTPPKGT
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgccgcggagaaagagaacggccgggagcagctcagacgggaccgaggattccgatttt
tccgccgaccttgagcacgccgatgcttccgataacggccggaggcggagcagcgctcgc
ctgacccgctcctccctgcgcctcagccagagctcacaagacgacggcccagacgtgtcc
gcagactcagcagcaccggcctccgtcttctcctccggccgcaggatcacgcgcagccag
cagggggcgagcagcaccacggccaaaaagtacccgctgcgacaaagccgctcatcaggc
tcggatactgaagctattgcctcatttgaccacacagacgggaagcacggggcggaccgg
gacgagactcctccccggaccccgacaggcaacgcctcttcttcagagtcggacctcgag
gtctccagctcaaacaacgagacggacgagaggctggccaaagagctgtcgctgaaggag
gcggctgcccacgacctctcccaccgccccaaacgacgccgattccacgaaagttacaac
ttcaacatgaagtgtcccacacctggatgcaactcactgggacatctgacaggaagacac
gagagacacttctccatttctggatgcccgctctaccacaacctctctgcagacgaatgc
aagggcaaagcatcaacgcgcgacaagctggctgaggagaggacgctgtcgcaccggcac
gacgagaacagacactccaccagaaaccaggcgccgagcgatcgtcagctgcgctacaag
gagaaggtgacggacctgaggaggaagagggactccggcctgaataaagagcagaaggac
aagtacatggagcaccggcaaagccacgggacgagccgggagcccctgttggagaacatc
accagcgactacgacctggagctgttcaggaaagcgcaggcacgtgcctcggacgacctt
gtaagagagaaaattcatcctcatctccacctcttttgccccttatctctctgtgttatc
cccccttgtgcctctttttctctgtttcagtctgcggacgctcctccacagccacaggag
gcgtctcagactctgatttttggcagttctgactccctctgtgaaccagannnnnnnnnn
nnnnnnnnnnnnnngctggacacctggtaccactccccgtacccggaggagtacgcccgc
ctggggaggctgtacatgtgcgagttctgcctcaagtacatgaagagtcagaccatcctg
cgcagacacatggccaaatgtgtgtggaagcatccgccaggagatgagatctacaggaag
accaacatctctgtcttcgaagtggatggaaagaagaacaagatctactgtcagaatctg
tgcctgctggccaaactctttctggaccacaagactctgtactacgacgtcgaacccttc
ctcttttacgtcatggccgaagccgacaacacgggctgtcacttggttggctacttctct
aaggagaagaactccttcctgaactacaacgtgtcctgcattctcaccatgcctcagtac
atgcggcagggttacggcaagatgctcatcgacttcagttacctgttatccaaggtggag
gagaaggtgggctctccagagcgccccctgtcggacctgggcctgatcagctacaggagt
tactggaaagacgttctgctgcgctacatgaacaactttcagggcaaggagatctccatt
aaagagatcagccaggagacggcggtgaacccggtggacatcgtcagcacgctgcaggcg
ctccagatgctgaaatactggaaggggaagcacctggtcctgaaacgacaggacctaatc
gatgactggaaggcgaaggagaccaaacggggtaacggcaagaccatagaccccacagcc
ttaaaatggaccccccctaaagggacataa

DBGET integrated database retrieval system