KEGG   Oryzias latipes (Japanese medaka): 101165851Help
Entry
101165851         CDS       T02443                                 

Gene name
tmx3
Definition
(RefSeq) protein disulfide-isomerase TMX3
  KO
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101165851 (tmx3)
Chaperones and folding catalysts [BR:ola03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101165851 (tmx3)
Membrane trafficking [BR:ola04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101165851 (tmx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
20
AA seq 477 aa AA seqDB search
MRREKKCSGCISCFFPHEAMAQEKASVILRVIAAVCITTVLGFVEDLDSTFKDTRVNDIW
LVDFYAPWCGYCKKLEPIWDEVGAELRSSGSPVRVGKMDATAYSGMASEFGVRGYPTIKL
LKADLAYNYKGPRTKDDIVEFANRVAGPAVRALPSTQMFEHMMKRHDVLFVYVGGDSPLK
EKYNDAASELIVYTYFFSASEDAVPESISMPELPAVVVFKDGDYFTYDEYEDGSLSSWVN
RERFQGYLQIDGFTLYELGETGKLVAIAVIDEKDATEESGRLKTLMQRVAKEYREHFNRV
FQFGHMDGSDYINSLIMGEVKVPSVIILNTSNEQYFLSSEPIETMEQLVQFISDVLNGSA
QAYGGDGFIQRIKRVAFDARSTIMSVFRSSPLLGCFLFGLPLGVISLMCYGICTAESDDG
SDDIDALKREGLTDEEEEEEEERQDTAELEAPEEEEEDEEEEEEEEGEKDPEEKKTD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagagagaagaagtgcagcggctgtatttcctgcttcttcccacacgaagcaatg
gcacaagagaaagcttctgtgatccttagagtgatagcggccgtttgcattaccacggtg
ctcggctttgttgaagatctagatagcacgtttaaagacaccagagtgaacgacatctgg
ctggttgatttttatgctccatggtgcggttactgtaaaaaactagaacccatctgggat
gaagtgggggcggagcttaggagctccggctcgccagtgcgtgtcggaaagatggatgca
actgcctactcaggaatggcgtcggagttcggcgttcgtggttaccccaccataaaactg
ctaaaggcagatctcgcatacaattacaaaggaccaagaacgaaagatgatatcgtggag
tttgccaacagggtggcaggaccggccgtgcgggcgcttcccagcacgcagatgtttgag
cacatgatgaaacggcacgacgtcctcttcgtgtacgttggcggggactctcccctgaaa
gagaaatacaacgatgcagcctctgagctcatcgtctatacatacttcttctcggcttca
gaggatgccgtgccagagtccatctccatgccggagcttcctgcggttgtggtctttaag
gacggagattattttacctacgatgagtacgaggacggcagcctgtcatcgtgggtgaac
agggagcgcttccaaggatacctccagattgatggctttacgttgtatgaactcggagaa
acaggaaaactcgtggcgattgcagtcatcgatgagaaggacgccacggaggagagcggc
agattaaagaccttgatgcagagggtggcgaaggaatacagagaacattttaacagagtt
ttccagtttggccacatggatggcagcgactacattaacagcctcattatgggtgaggta
aaagtgccctccgtaatcatcctcaacacgtccaacgagcagtacttcctgtccagtgag
ccgattgagaccatggagcagctggtccagttcatcagcgatgttttgaacggttctgca
caggcttatggaggcgatggcttcattcagaggatcaaacgggtggcgtttgatgccagg
tccaccattatgtctgtgtttcgcagctctccactgctgggctgcttcctgttcggccta
ccgctgggtgtaattagcctgatgtgctacggcatctgcacagccgagtcggatgacggt
tcggatgacatagacgcgctgaaaagggagggcctcactgatgaggaggaggaagaggag
gaggagaggcaagacactgctgagctggaggcccccgaagaagaagaagaagacgaagaa
gaggaggaggaggaagaaggagagaaagaccccgaagagaagaaaactgattaa

DBGET integrated database retrieval system