KEGG   Oryzias latipes (Japanese medaka): 101165851Help
Entry
101165851         CDS       T02443                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101165851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 458 aa AA seqDB search
MAQEKASVILRVIAAVCITTVLGFVEDLDSTFKDTRVNDIWLVDFYAPWCGYCKKLEPIW
DEVGAELRSSGSPVRVGKMDATAYSGMASEFGVRGYPTIKLLKADLAYNYKGPRTKDDIV
EFANRVAGPAVRALPSTQMFEHMMKRHDVLFVYVGGDSPLKEKYNDAASELIVYTYFFSA
SEDAVPESISMPELPAVVVFKDGDYFTYDEYEDGSLSSWVNRERFQGYLQIDGFTLYELG
ETGKLVAIAVIDEKDATEESGRLKTLMQRVAKEYREHFNRVFQFGHMDGSDYINSLIMGE
VKVPSVIILNTSNEQYFLSSEPIETMEQLVQFISDVLNGSAQAYGGDGFIQRIKRVAFDA
RSTIMSVFRSSPLLGCFLFGLPLGVISLMCYGICTAESDDGSDDIDALKREGLTDEEEEE
EEERQDTAELEAPEEEEEDEEEEEEEEGEKDPEEKKTD
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagagaaagcttctgtgatccttagagtgatagcggccgtttgcattaccacg
gtgctcggctttgttgaagatctagatagcacgtttaaagacaccagagtgaacgacatc
tggctggttgatttttatgctccatggtgcggttactgtaaaaaactagaacccatctgg
gatgaagtgggggcggagcttaggagctccggctcgccagtgcgtgtcggaaagatggat
gcaactgcctactcaggaatggcgtcggagttcggcgttcgtggttaccccaccataaaa
ctgctaaaggcagatctcgcatacaattacaaaggaccaagaacgaaagatgatatcgtg
gagtttgccaacagggtggcaggaccggccgtgcgggcgcttcccagcacgcagatgttt
gagcacatgatgaaacggcacgacgtcctcttcgtgtacgttggcggggactctcccctg
aaagagaaatacaacgatgcagcctctgagctcatcgtctatacatacttcttctcggct
tcagaggatgccgtgccagagtccatctccatgccggagcttcctgcggttgtggtcttt
aaggacggagattattttacctacgatgagtacgaggacggcagcctgtcatcgtgggtg
aacagggagcgcttccaaggatacctccagattgatggctttacgttgtatgaactcgga
gaaacaggaaaactcgtggcgattgcagtcatcgatgagaaggacgccacggaggagagc
ggcagattaaagaccttgatgcagagggtggcgaaggaatacagagaacattttaacaga
gttttccagtttggccacatggatggcagcgactacattaacagcctcattatgggtgag
gtaaaagtgccctccgtaatcatcctcaacacgtccaacgagcagtacttcctgtccagt
gagccgattgagaccatggagcagctggtccagttcatcagcgatgttttgaacggttct
gcacaggcttatggaggcgatggcttcattcagaggatcaaacgggtggcgtttgatgcc
aggtccaccattatgtctgtgtttcgcagctctccactgctgggctgcttcctgttcggc
ctaccgctgggtgtaattagcctgatgtgctacggcatctgcacagccgagtcggatgac
ggttcggatgacatagacgcgctgaaaagggagggcctcactgatgaggaggaggaagag
gaggaggagaggcaagacactgctgagctggaggcccccgaagaagaagaagaagacgaa
gaagaggaggaggaggaagaaggagagaaagaccccgaagagaagaaaactgattaa

DBGET integrated database retrieval system