KEGG   Oryzias latipes (Japanese medaka): 101166138Help
Entry
101166138         CDS       T02443                                 

Definition
D-amino-acid oxidase-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101166138
   00330 Arginine and proline metabolism
    101166138
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    101166138
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    101166138
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101166138
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     101166138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 345 aa AA seqDB search
MRVAVIGAGVIGLSTAQSIYEQYHSTVSPLTIEVYADRFTPLTTSDGAAGFWQPYLYDKG
NVQETKWNKETFDYLLSWLNSPESVKMGVFLQSGYNIFTEPAPDPSFKEAVLGFRHLTQR
ELQLFPGYNFGWFNTALMVEGKSYLPWLMDWLQQRGVKFYNKKINSFKELSESGADVIIN
CTGVRSGELQPDPDLKPGRGQIIKVDAPWLKHWVITHNMKTGVYNSPYIIPGSRLVTVGG
LFQLGNWSEQNNSADHKHMWEEACQLEPSLKHARIVEDWAGLRPVRSKVRLERETLQSGA
STIEVIHNYGHGGFGLTIHRGCAQEAARLFGQIVQQKHKATKARL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttgcagtgatcggagctggcgtcattggcctgtccacggcccagagcatctat
gagcagtatcactcaacggttagtccgctcaccattgaggtgtatgcagaccgattcact
ccactgaccaccagcgatggagctgcaggcttctggcagccatacctctatgacaagggc
aatgtccaggagacgaaatggaacaaggagacatttgactacctgctgagctggcttaac
tcacccgagtctgttaaaatgggtgtattccttcagtctggctataacatcttcactgaa
cctgctccagatccctcattcaaagaggccgtcctcggcttcagacacctcacacaacgg
gaactgcagttgtttcctggatacaattttggctggtttaacacggctctgatggtggaa
ggaaagtcatatttaccgtggttgatggactggcttcaacaaaggggggtcaaattttat
aacaagaaaataaactctttcaaagagctgtctgagagcggggcagacgtgatcataaac
tgcacaggggtgagatcaggagagctgcagccagacccagacctgaagccgggccgaggg
cagattataaaggtggatgctccctggctgaaacactgggttatcacccacaacatgaag
acgggagtgtacaactcaccgtacatcattccagggagccgcctcgtgacagttggtggg
cttttccagttaggaaattggagcgaacaaaacaactctgccgaccataagcatatgtgg
gaagaagcttgtcagctggaaccaagcctcaagcatgccaggatcgtggaggactgggct
ggtctcaggcccgtccgcagcaaagtgcgcctggaacgcgagactttacagtcaggcgcc
tctacaatagaggtgatacacaactacggccatggaggctttggactcaccattcacaga
ggctgcgcccaggaggctgccaggctgttcggccagatcgttcagcaaaagcacaaagct
acaaaagctcgtctgtag

DBGET integrated database retrieval system