KEGG   Oryzias latipes (Japanese medaka): 101166385Help
Entry
101166385         CDS       T02443                                 

Gene name
olezh1
Definition
histone-lysine N-methyltransferase EZH1-like
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101166385 (olezh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 766 aa AA seqDB search
MEETAHPAPGTSVAPSQPRPPPCTFAPSRSLLEWRRRVKSEYMRLRQLKRLKKADEVKTL
FSSNREKIEQQTTVLNSEWSTLKIQSIPLSVSNVALANKKMCSVEFGFPGFKAQAIAMRP
LSTVAGIPFMYSWSPLQHNFMVEDETFLHNIPYMGDEVLEQDEAFLEELIDNYDGVHGDR
EGGFISDEVFKELVDALSQYSDHEEDEEEEGAAAAAVDVTEKKDDERMMRRSLVEGSEET
KAGAFIRRKRRSMTEVRDLSGKRIPSDKIFTAIASMFPYKGTTEELKEKYKDLLEPSSQV
KLPPLCTPNLDGPFAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFRATPNVYKRKSKEIR
METEPCGEDCFLLQKGAKEFVDQNMRRSQRSRRRRRQQRATSSSCPGPSASAEESKEGDS
DHESTSSSEGNSRSQTPTKQRPGDDCADQQACCVVPWSGAEESLFRVLHGTYFNNFCSIA
RLIGTKTCKQVYEFAVKEVLIHRVPFEDGGILPQKKKRKHRLWAKIQLKKDNSSNQVYNY
QPCDHPDHPCDNSCPCVMTQNFCEKFCQCENECQNRFPGCRCKTQCNTKQCPCYLAVREC
DPDLCMTCGAADHWDSKVVTCKNCSIQRGLKKHLLLAPSDVAGWGTFIKEPVQKNEFISE
YCGELISQDEADRRGRIYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVV
MVNGDHRIGIFAKRAILQGEELFFDYRYSQADALKYVGIEREVDMT
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaacagcacatcctgcccctggtaccagtgttgccccatctcagccaaggcct
ccgccctgcacttttgccccgtcccgcagcctgctggagtggaggcggagggtcaagtca
gagtatatgcgcctgcgccaattaaaacgccttaaaaaagcagacgaggtcaagaccctg
ttctcatccaaccgggagaagattgagcagcagactactgtccttaactcagagtggtcc
acgcttaagattcagtccatcccgctgtctgtgtctaatgtagcactggctaataagaag
atgtgttcggtggagtttggtttcccaggattcaaagctcaagccatcgccatgaggcca
ctgtcaacagtggcagggatcccattcatgtactcctggtctcccctgcagcacaatttc
atggtagaggatgagacgttcctccataacatcccttacatgggcgatgaggtactggaa
caggacgaggctttcctggaggagctcattgataactatgatggtgtccatggtgacaga
gagggtggttttatcagtgacgaggtctttaaagagctggtggacgccctcagccagtat
tctgaccatgaagaagacgaggaggaggaaggagccgcagcagcagccgtggacgttaca
gagaagaaagacgacgagaggatgatgagaaggagcttagtggaaggctcagaggagacg
aaggctggagcgttcatcagaaggaaaagaagaagcatgactgaggtgagagatttgtct
ggcaagaggatccccagcgataaaatatttacagccatcgcctcaatgttcccctacaaa
ggcacaacagaggagctgaaggaaaagtacaaggacctattggagccctccagtcaagtg
aaactgccccccctgtgcacccctaacttagatggaccttttgcaaagtctgttcagaga
gagcagtccttacactccttccacactctcttctgcagacggtgtttcaaatacgactgt
ttcctccacccttttcgtgctacgcctaatgtttacaagaggaaaagtaaggagatccgc
atggagacagagccctgtggggaggactgcttcctgttgcagaaaggggctaaagagttt
gtggatcagaatatgcgaagatcacagaggtctcggcggcggcggaggcagcaacgtgct
accagttcaagttgtcctggaccgtctgcatctgcagaggagagcaaagagggtgacagt
gaccatgaaagcacttcctcttcagaagggaattcccgcagccagactcccaccaagcag
cgtccaggggatgactgtgcagaccagcaggcttgctgcgtggttccgtggagcggagcc
gaggaatctctgttccgcgtgctgcacggcacatacttcaacaacttttgctccatcgct
cgccttattggtaccaaaacctgcaagcaggtatatgagtttgcggtaaaagaggttctt
atccatcgtgttccttttgaagatggtggcattttgccccaaaagaaaaaaaggaaacac
aggttatgggcaaagatccagctgaagaaagataactcgtccaatcaagtgtacaactat
cagccatgtgaccaccccgaccacccatgtgacaactcctgtccttgtgtgatgacccaa
aacttttgtgagaagttctgccagtgtgagaatgaatgccagaaccgcttcccaggctgc
agatgtaagacccagtgtaacaccaagcagtgtccctgctacttggctgtgagggaatgc
gacccagatctgtgcatgacttgtggtgctgcagaccactgggacagcaaagtggtgact
tgcaagaactgcagcattcaaagaggcctaaaaaagcatcttctactagctccatcggac
gttgccgggtggggcacattcatcaaagagcctgtccaaaagaatgagtttatctcagaa
tactgcggagagctgatctctcaggatgaagcggatcggcgtggaaggatctatgacaag
tacatgtccagcttccttttcaatttaaacaatgactttgtagtggatgccacacgaaag
gggaacaaaattcgctttgcaaatcactcagttaatcccaactgctatgctaaagtggtg
atggtgaatggagatcaccgcattgggatctttgcaaaacgagctatcttgcaaggagag
gaactcttctttgactacagatacagccaagctgatgccctcaagtatgttggaatagag
agggaggtagacatgacttag

DBGET integrated database retrieval system