KEGG   Oryzias latipes (Japanese medaka): 101166486Help
Entry
101166486         CDS       T02443                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101166486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 623 aa AA seqDB search
MEPETHTEPVGDEEPLFSNLDLFLFSLIIGLVVYYFMSRKKPEPIPEFKKIDTPQVSQRE
TSFIEKMKKTGKNIIVFYGSQTGTAEEFANRLSKDAQRYGMKGMAADPEEYTMGELARMS
EIKNSLAIFCMATYGEGDPTDNAQDFYDWLQENDDEDLSGLNYTVFALGNKTYEHYNAMG
KYVDKRLEELGAKRIFDLGLGDDDSNLEEDFVSWREQFWPAVCEHFGVEASADELSIRQY
ELKLHNDVNMNKVFTGEIGRLKSFEVQKPPFDAKNPFLAPVTVNRRLNKAGDRHLMHLEL
DITGSKLRYESGDHVAVFPTNDSALVNRLGEILGVDLDVVISLNNLDEESNKKHPFPCPT
TYRTALTHYLDIMNPPRTNVLYELAQYASEPKDQENMRKMASSSPEGKALYQTWVLDSCR
NILAILEDMPSLKPPVDHLCELLPRLQARYYSIASSSKVHPNSIHICAVVVEYSTKTGRV
NKGVATNWLKNKLVNGHKSTVPMFIRKSQFRLPFKATNPVIMIGPGTGIAPFMGFIQERG
WLKEQGKEVGETVLYFGCRHKNEDYIYQEELEDAEKSGVLTQLNVAFSRDQDHKVYVQHL
LKKNKEHVWKLIHTDNAHLYVCG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggagccagagacccacaccgagcccgttggggatgaagagccgctcttcagcaacctg
gacctcttcctcttttccctcatcattggccttgtcgtttattatttcatgtcccgtaag
aagccagagcccatcccagagtttaaaaagatcgacacaccacaagtctcacaacgagag
acgagtttcattgagaagatgaagaaaactgggaagaacatcatcgtgttctacggctcc
cagacgggaacagcagaggaatttgccaacaggctgtccaaagatgctcagcgctatggc
atgaaaggaatggctgctgatccagaggagtacaccatgggggaactggcccgtatgtct
gagatcaagaactcactggctattttttgtatggccacttacggtgaaggcgacccgacg
gataacgcccaggacttctatgactggctgcaggagaacgatgatgaagacctctctgga
ctgaactacactgtgtttgcgctgggaaataaaacgtacgaacactacaacgcgatgggg
aaatacgtggacaaaaggctggaggagcttggagccaaacgcatctttgatctcggtttg
ggagacgacgacagcaacctggaggaggactttgtttcgtggagagagcagttctggccg
gccgtctgcgagcactttggggtggaggcttcagcagatgaactcagtatccggcagtat
gagctgaagctccacaacgacgtcaacatgaacaaagtgttcaccggagaaatcggccgc
ctgaagagttttgaggtccaaaagccgccttttgatgctaaaaaccccttcttggctccc
gtcaccgtcaaccgcagactcaacaaagcaggggatcggcatcttatgcacctggagcta
gacatcacaggctccaagctcaggtacgagtcaggagaccatgttgctgtcttccccaca
aatgactctgcactggtgaacagactgggagagatccttggtgtggaccttgatgtggtt
atctccctgaacaaccttgatgaggagtccaacaaaaagcatccttttccctgtcccacc
acctaccgtactgccctcacacactacctggacatcatgaaccctccccgcaccaacgtc
ctctacgaactggcacagtacgcctccgagcccaaagaccaggaaaatatgcgcaagatg
gcctcttcctcccccgagggcaaggctctttaccagacgtgggtgttggactcctgcagg
aacatcctggccatcctggaggacatgccttctttaaagcctccggttgatcatctgtgt
gagctgctgcctcgcctccaggctcgctactattccatagcttcctcttctaaagttcac
cccaatagcatccacatctgtgccgtggtggtggagtactccaccaagacggggcgggtc
aacaaaggagtggcgacaaactggctgaagaacaaactggttaacggtcacaaatcgact
gttcccatgttcatccgcaagtcccagttccgcctgcctttcaaagccacgaaccccgtc
atcatgatcggcccggggacaggaatcgctccgttcatgggcttcatccaggagagaggc
tggctcaaagagcaaggtaaagaggtcggggagacggtgttgtatttcggctgcagacac
aagaacgaggactacatttaccaggaggagctggaggacgcggaaaagagcggcgtttta
actcagctgaacgttgccttctccagagaccaggatcacaaggtgtacgtgcagcatctc
ctgaagaaaaataaggaacacgtttggaaactgattcacacggacaacgctcatctctac
gtctgcgggtaa

DBGET integrated database retrieval system