KEGG   Oryzias latipes (Japanese medaka): 101166546Help
Entry
101166546         CDS       T02443                                 

Gene name
comt
Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00140  Steroid hormone biosynthesis
ola00350  Tyrosine metabolism
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101166546 (comt)
  Amino acid metabolism
   00350 Tyrosine metabolism
    101166546 (comt)
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     101166546 (comt)
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101166546 (comt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_31 PCMT CmcI Methyltransf_25 GCD14 Cons_hypoth95 Methyltransf_16 Ubie_methyltran
Motif
Other DBs
NCBI-GeneID: 101166546
NCBI-ProteinID: XP_004069145
UniProt: H2MGV3
Position
5
AA seq 264 aa AA seqDB search
MLLTLLYSCTGGAAVLYALYRWIIPFIVQYHAGLALIWHDKFVEGMLDMLTRSTRPQRLL
AAVQKNATRGDPRSVVRAIDQFCRHKEWAMNVGDEKGCILDSVVSEANPTYVLELGTYCG
YSTVRIASLLSPNSKLITVEFNPEYAKIARQVIAWAGLQDKIHLVEGASGDLIPKMQEMF
GVKTFDLVFLDHWKDRYLPDTKLMEKCGLLRKGSILLADNVICPGTPDYLEYIRNSPQYE
SQYFKSHLEYTKVEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgactcttctatacagttgcactggtggagcagctgtcctgtacgctctgtac
agatggatcatccccttcattgtgcagtatcacgctggactggcgctcatctggcacgac
aagtttgtggagggaatgctggacatgctgacccgaagcactcgtcctcagcggcttctg
gctgcagtacagaaaaacgccactagaggggaccctcgcagcgtggttagagctattgat
cagttctgcaggcataaggaatgggccatgaatgtgggggatgaaaaaggctgcattctg
gactctgtagtgtctgaggcaaaccccacttatgtgttggagttggggacctactgtggc
tactccacagtgcgcattgccagcctgctgtcaccaaacagcaagcttataactgttgag
tttaatccagaatatgctaaaatagctcggcaggttattgcatgggcagggctgcaggat
aagattcatttagttgaaggagcttctggagacttgatccccaaaatgcaagagatgttt
ggggtgaaaacattcgacttggttttcttggaccactggaaagatcgctatcttcctgac
acaaagctgatggagaagtgtggcctcctgaggaaaggcagcatcttgctggcagacaac
gtcatctgcccgggaactccagattacctcgagtacattcgaaacagccctcagtatgaa
agccagtacttcaaatctcacctggagtacactaaagtagaggacggcttggagaaatct
gtctttttgggttga

DBGET integrated database retrieval system