KEGG   Oryzias latipes (Japanese medaka): 101166546Help
Entry
101166546         CDS       T02443                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:ola00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ola00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 264 aa AA seqDB search
MLLTLLYSCTGGAAVLYALYRWIIPFIVQYHAGLALIWHDKFVEGMLDMLTRSTRPQRLL
AAVQKNATRGDPRSVVRAIDQFCRHKEWAMNVGDEKGCILDSVVSEANPTYVLELGTYCG
YSTVRIASLLSPNSKLITVEFNPEYAKIARQVIAWAGLQDKIHLVEGASGDLIPKMQEMF
GVKTFDLVFLDHWKDRYLPDTKLMEKCGLLRKGSILLADNVICPGTPDYLEYIRNSPQYE
SQYFKSHLEYTKVEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgactcttctatacagttgcactggtggagcagctgtcctgtacgctctgtac
agatggatcatccccttcattgtgcagtatcacgctggactggcgctcatctggcacgac
aagtttgtggagggaatgctggacatgctgacccgaagcactcgtcctcagcggcttctg
gctgcagtacagaaaaacgccactagaggggaccctcgcagcgtggttagagctattgat
cagttctgcaggcataaggaatgggccatgaatgtgggggatgaaaaaggctgcattctg
gactctgtagtgtctgaggcaaaccccacttatgtgttggagttggggacctactgtggc
tactccacagtgcgcattgccagcctgctgtcaccaaacagcaagcttataactgttgag
tttaatccagaatatgctaaaatagctcggcaggttattgcatgggcagggctgcaggat
aagattcatttagttgaaggagcttctggagacttgatccccaaaatgcaagagatgttt
ggggtgaaaacattcgacttggttttcttggaccactggaaagatcgctatcttcctgac
acaaagctgatggagaagtgtggcctcctgaggaaaggcagcatcttgctggcagacaac
gtcatctgcccgggaactccagattacctcgagtacattcgaaacagccctcagtatgaa
agccagtacttcaaatctcacctggagtacactaaagtagaggacggcttggagaaatct
gtctttttgggttga

DBGET integrated database retrieval system