KEGG   Oryzias latipes (Japanese medaka): 101166655Help
Entry
101166655         CDS       T02443                                 

Definition
bifunctional protein NCOAT-like
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
ola  Oryzias latipes (Japanese medaka)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 910 aa AA seqDB search
MVHKEKPVDTQQLVVESSPSPVSGEPCVEAPGPVEDSGEVESTGHRKFISGVVEGFYGRP
WTMEQRKELFRRQQKWGLNTYLYAPKDDYKHRMFWRELYSVEEAEQLMTLIAAAKEHGIE
FIYAISPGLDITFSNQKEVSALKRKLDQVTHFGCKSFALLFDDIDHNMCPADKEVFSSFA
HAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVPQSPYLHTVGEKLLPSIDVLWTGP
KVVSKDIPVESIEEVSKILRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLT
NPNCEFETNFVAIHTLATWYKSNMNGVRKDVVMTDGEESTVSIQIKLENEGSDEELETDV
LYSPQIALKLALTEWLSEFRVPHQYNSRQVPQSGAKSTTIDVTSMTAPALCSSTSVTSVF
QQPIMSPAIPPLCLDPLPLPITKAPQEKDSDEEPMEMVVEKLDEPEPEVDPESKHAGPIL
NDKMAEDLKPMDTDKEGLVETKSPEESIQEDSGSDIAPMQTDDLLKQDVFVPGPNEKPLF
IAEPLSLDDLCLLAELFYLPYEHGPKAMQMLKEFNWLRANSSVVSVNCKRKESEKVSEWQ
SRAQKFEDMCCSVIEMFTRLSNIANRTILYDLYPYIWDIKSIISMVKSFVLWLGCRSQSS
AQFLRGDQEPWAFRGGLAGEFQRLLPIEAANDLFYQPPPSLPTSKIYTIRPYYPKDETAV
YKICKEMYCEGMEDELFSQEDPDLIGDRLVGGLLTLSSDYGFVLEDEAGICGYAVGTVDV
KPFIKKCKLSWLPFMQEKYNKPDCEKDLTEAEKMMLSFHEEEDGLPDSFLSNFPSLIKVD
IHAKVTDPSVAKSMMGCLLSSLKANGSRGAFCKVRQTDKRMLDFYSKLGCFEVAKMEGFP
KDIIIMGRSL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggtccataaagaaaaaccagtggatactcaacaactagttgttgaaagcagccccagc
ccagtctccggagagccctgcgtggaggccccaggcccggtggaagactccggcgaggtg
gagtcgacgggtcaccgaaaattcatcagcggtgtcgtggaaggcttttatggccgccca
tggacaatggaacagaggaaagagctgttcagaaggcagcagaaatggggtctgaacaca
tacctttatgcaccaaaagatgactacaaacacagaatgttctggagagagctgtattcg
gtggaagaagcagaacaactcatgaccttaattgctgctgcaaaggagcatggaattgag
ttcatttatgccatttctcctgggttagacatcaccttttctaaccagaaagaagtttct
gctctcaagagaaaactcgatcaggttactcattttggctgcaagtcatttgccttactt
tttgatgacattgaccacaatatgtgccctgctgataaagaagtcttcagctcctttgca
catgctcaggtttccatcaccaatgaaatctaccagtacctgggagagcctgaaaccttc
cttttttgccccacagagtactgtggaacattctgctacccaaatgtcccccagtcgccc
tacctgcacacagtgggtgagaaactactccccagcatagatgtgttatggacaggtccc
aaagtggtctccaaagatattcctgtggagtcgattgaggaggtgtcgaaaatccttaga
cgggccccagtcatctgggacaatattcatgctaatgattatgaccagaagaggctcttc
ttgggtccatataagggtcgctccacagagctcattccgagactgaagggagtcctcacc
aaccccaactgcgagtttgaaaccaactttgtggccattcacactctagccacctggtac
aagtcaaatatgaacggagttcgcaaagatgtggtcatgactgacggcgaggagagcacc
gtgtccatccagatcaagttggagaatgaaggaagtgatgaggagctggagacagacgtg
ctttacagcccacagatcgctctaaaactggctcttactgagtggctttcagagtttcgt
gtccctcaccagtacaacagtcgacaggttccccagagtggtgccaaaagcacaaccatc
gatgtgacatccatgacagctccagctctttgctcatccacatcggtcacatctgtattt
caacagcccataatgtcacctgcaatcccccccctttgcttggacccacttccactcccg
attacaaaagccccccaagagaaggactcggatgaggagccaatggagatggttgttgag
aagctggacgaaccagagccagaagttgatccagagagcaaacatgctggtcccatcctg
aatgacaagatggctgaagacctaaagcctatggacactgacaaagagggtcttgtagag
accaagtcccccgaagagtcaatccaggaggattctgggagtgacatcgcccccatgcag
acagacgatctgctcaaacaggatgtatttgtgcccggacccaacgagaagccgctgttc
atcgcagagccgctctcacttgatgacctgtgcttgctggcagagctcttctacctgcct
tatgaacatggacccaaagccatgcagatgttgaaggagttcaactggctaagagccaac
agcagtgttgtcagtgtgaactgcaaaaggaaggaaagcgagaaggtttctgaatggcag
tcgcgtgcacagaagtttgaggacatgtgctgctccgtcattgagatgtttacccgactg
tcgaacatcgccaaccgcaccatcctgtacgacctctacccttacatttgggacatcaag
agcatcatttctatggtcaagtcttttgtcctgtggttagggtgtcgtagtcagtcctca
gcacagttccttagaggagaccaagagccctgggcctttaggggaggtctagcaggagag
ttccagagattgttgccaatagaagcggcaaacgatcttttctaccaaccgccaccatcc
ctgccaacttccaaaatttacactatcaggccatattatcccaaagatgagactgcagtt
tataaaatctgtaaggaaatgtactgtgaaggaatggaggatgaactgttctcccaggag
gatcctgacctcataggagacaggttggtcggaggcctgctaacgctgagctcagactac
ggtttcgtgctggaggatgaagctgggatttgcggttatgccgtcggcacagtagatgtg
aagcccttcatcaagaagtgcaaactgagctggcttcccttcatgcaggaaaaatacaac
aaaccagactgtgaaaaagatctcaccgaggctgaaaagatgatgctgagtttccacgag
gaggaggatggtcttccagactcttttctgtccaactttccttctctcatcaaagtggac
attcacgccaaagtcacagaccccagcgtggccaagagcatgatgggatgtttactgtct
tcacttaaagctaacggttctcgcggagcgttttgtaaggttcgtcagactgataagaga
atgttggacttctatagtaagctgggatgcttcgaggtggccaaaatggaaggatttccc
aaagacatcatcattatgggccggagcctttga

DBGET integrated database retrieval system