KEGG   Oryzias latipes (Japanese medaka): 101166707Help
Entry
101166707         CDS       T02443                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101166707
   00670 One carbon pool by folate
    101166707
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     101166707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 163 aa AA seqDB search
MTRTLNGIVAVCPDLGIGKGGNLPWHPLRLSKDFALFRKMTSTPLVAGRQNVVIMGRKTW
FSIPEKNRPLQNRINIVLSRQLKAPPAGAHFVAADFAAALRLVDSELAERADQVWIIGGS
SIYKEMMESPAPRRLIVTRVQKQFECDTFFPEIRPEQFRLLPE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactctgaacggcatcgtggcggtgtgccccgacctgggcatcgggaagggt
gggaacctgccgtggcacccgctgcggctcagcaaggattttgcgctctttcggaagatg
acgtcaacaccattagtggcaggtcggcagaatgtggtgatcatgggcaggaagacgtgg
ttttccatccctgagaagaaccggcctctgcagaaccgcatcaacatcgtcctcagcaga
cagttgaaggcgcccccagctggagctcattttgtggcggcagacttcgccgcggcgctc
aggctcgtggactcggagctggctgagcgggctgaccaggtgtggatcatcggcggcagc
tccatctataaggaaatgatggagagcccggcacccaggaggctgatagtgacacgcgtc
cagaagcagtttgagtgcgacacattcttccctgaaatccggcctgagcagttccgtctc
ctgccagagtaa

DBGET integrated database retrieval system