KEGG   Oryzias latipes (Japanese medaka): 101166707Help
Entry
101166707         CDS       T02443                                 

Gene name
dhfr
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00670  One carbon pool by folate
ola00790  Folate biosynthesis
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101166707 (dhfr)
   00670 One carbon pool by folate
    101166707 (dhfr)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     101166707 (dhfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1 US2
Motif
Other DBs
NCBI-GeneID: 101166707
NCBI-ProteinID: XP_023813840
Position
9
AA seq 189 aa AA seqDB search
MTRTLNGIVAVCPDLGIGKGGNLPWHPLRLSKDFALFRKMTSTPLVAGRQNVVIMGRKTW
FSIPEKNRPLQNRINIVLSRQLKAPPAGAHFVAADFAAALRLVDSELAERADQVWIIGGS
SIYKEMMESPAPRRLIVTRVQKQFECDTFFPEIRPEQFRLLPEFPGVSQELQEENGVSYK
FEVYESIQQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactctgaacggcatcgtggcggtgtgccccgacctgggcatcgggaagggt
gggaacctgccgtggcacccgctgcggctcagcaaggattttgcgctctttcggaagatg
acgtcaacaccattagtggcaggtcggcagaatgtggtgatcatgggcaggaagacgtgg
ttttccatccctgagaagaaccggcctctgcagaaccgcatcaacatcgtcctcagcaga
cagttgaaggcgcccccagctggagctcattttgtggcggcagacttcgccgcggcgctc
aggctcgtggactcggagctggctgagcgggctgaccaggtgtggatcatcggcggcagc
tccatctataaggaaatgatggagagcccggcacccaggaggctgatagtgacacgcgtc
cagaagcagtttgagtgcgacacattcttccctgaaatccggcctgagcagttccgtctc
ctgccagagttccctggagtgtctcaggagcttcaggaggagaacggcgtttcctacaag
tttgaggtctacgagagcatccagcagtga

DBGET integrated database retrieval system