KEGG   Oryzias latipes (Japanese medaka): 101166707Help
Entry
101166707         CDS       T02443                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ola00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ola00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 163 aa AA seqDB search
MTRTLNGIVAVCPDLGIGKGGNLPWHPLRLSKDFALFRKMTSTPLVAGRQNVVIMGRKTW
FSIPEKNRPLQNRINIVLSRQLKAPPAGAHFVAADFAAALRLVDSELAERADQVWIIGGS
SIYKEMMESPAPRRLIVTRVQKQFECDTFFPEIRPEQFRLLPE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcactctgaacggcatcgtggcggtgtgccccgacctgggcatcgggaagggt
gggaacctgccgtggcacccgctgcggctcagcaaggattttgcgctctttcggaagatg
acgtcaacaccattagtggcaggtcggcagaatgtggtgatcatgggcaggaagacgtgg
ttttccatccctgagaagaaccggcctctgcagaaccgcatcaacatcgtcctcagcaga
cagttgaaggcgcccccagctggagctcattttgtggcggcagacttcgccgcggcgctc
aggctcgtggactcggagctggctgagcgggctgaccaggtgtggatcatcggcggcagc
tccatctataaggaaatgatggagagcccggcacccaggaggctgatagtgacacgcgtc
cagaagcagtttgagtgcgacacattcttccctgaaatccggcctgagcagttccgtctc
ctgccagagtaa

DBGET integrated database retrieval system