KEGG   Oryzias latipes (Japanese medaka): 101166727Help
Entry
101166727         CDS       T02443                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ola01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ola00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ola04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 304 aa AA seqDB search
MAVLLLSSLLLAAPVLLVVSGPVPGSTNKTVPLILWHGMGDSCCNPLSMGAIKKMIEQEI
AGIYVLSLMIGKNVVEDTENGFFLDVNHQVSMVCSQLAQDPNLQGGYNAMGFSQGAQFLR
AVAQRCPSPPMKKLISVGGQHQGVYGLPRCPGESSHLCDMIREALNRGAYSDLVQKHLVQ
AQYWHDPLNDDLYKKHSLFLADINQERSVNETYKKNLQQLEKFVMVKFLQDSVVDPVDTE
WFGFLKTGQAKVTETLQESDLYKQDRLGLAAMDKAGKLVFLATEGDHLQFSKEWFDANLL
PYLR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctcctcctgtccagtctcctgctggctgcgccagtcctcctggtggtgtcc
ggaccggttcctggctccaccaacaagacggtgcctctgatactgtggcatggaatgggt
gacagctgctgcaacccgctcagcatgggcgccataaagaagatgatcgagcaggagatc
gctggcatctatgttctgtcgctgatgatcgggaaaaatgtggtggaggacacagagaac
gggtttttcctggatgtgaaccaccaggtgtcgatggtgtgcagtcagctggctcaggac
ccaaacctacaaggggggtataacgccatgggcttctcacagggggcgcagttcctgaga
gctgtggctcagcgatgtccctccccaccaatgaagaagctgatatctgttgggggccag
caccaaggtgtgtatgggctgcccaggtgtcccggcgagagctcccacctgtgcgacatg
atccgcgaggctctgaacaggggggcgtacagtgacctggtgcagaagcacctggtgcag
gcccagtactggcacgacccgctcaacgacgacctgtacaagaagcacagcctgttcctg
gcagacattaaccaggagaggagcgtaaacgagacgtacaagaagaatctccagcagttg
gagaagtttgtgatggtgaagtttctgcaggactcggtggtggatcctgttgacacggag
tggttcggcttcctgaaaacaggccaagccaaagtgacggagactctgcaggagagcgac
ctctacaaacaggaccggttgggcctcgctgccatggacaaagccggaaagctggtcttc
ctggctacagagggagaccacctgcagttctccaaggaatggtttgacgccaacctgctg
ccgtacctgaggtag

DBGET integrated database retrieval system