KEGG   Oryzias latipes (Japanese medaka): 101166727Help
Entry
101166727         CDS       T02443                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:ola00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101166727
  Lipid metabolism
   00062 Fatty acid elongation
    101166727
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101166727
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     101166727
Lipid biosynthesis proteins [BR:ola01004]
 Fatty acid synthase
  Component type
   101166727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 304 aa AA seqDB search
MAVLLLSSLLLAAPVLLVVSGPVPGSTNKTVPLILWHGMGDSCCNPLSMGAIKKMIEQEI
AGIYVLSLMIGKNVVEDTENGFFLDVNHQVSMVCSQLAQDPNLQGGYNAMGFSQGAQFLR
AVAQRCPSPPMKKLISVGGQHQGVYGLPRCPGESSHLCDMIREALNRGAYSDLVQKHLVQ
AQYWHDPLNDDLYKKHSLFLADINQERSVNETYKKNLQQLEKFVMVKFLQDSVVDPVDTE
WFGFLKTGQAKVTETLQESDLYKQDRLGLAAMDKAGKLVFLATEGDHLQFSKEWFDANLL
PYLR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcctcctcctgtccagtctcctgctggctgcgccagtcctcctggtggtgtcc
ggaccggttcctggctccaccaacaagacggtgcctctgatactgtggcatggaatgggt
gacagctgctgcaacccgctcagcatgggcgccataaagaagatgatcgagcaggagatc
gctggcatctatgttctgtcgctgatgatcgggaaaaatgtggtggaggacacagagaac
gggtttttcctggatgtgaaccaccaggtgtcgatggtgtgcagtcagctggctcaggac
ccaaacctacaaggggggtataacgccatgggcttctcacagggggcgcagttcctgaga
gctgtggctcagcgatgtccctccccaccaatgaagaagctgatatctgttgggggccag
caccaaggtgtgtatgggctgcccaggtgtcccggcgagagctcccacctgtgcgacatg
atccgcgaggctctgaacaggggggcgtacagtgacctggtgcagaagcacctggtgcag
gcccagtactggcacgacccgctcaacgacgacctgtacaagaagcacagcctgttcctg
gcagacattaaccaggagaggagcgtaaacgagacgtacaagaagaatctccagcagttg
gagaagtttgtgatggtgaagtttctgcaggactcggtggtggatcctgttgacacggag
tggttcggcttcctgaaaacaggccaagccaaagtgacggagactctgcaggagagcgac
ctctacaaacaggaccggttgggcctcgctgccatggacaaagccggaaagctggtcttc
ctggctacagagggagaccacctgcagttctccaaggaatggtttgacgccaacctgctg
ccgtacctgaggtag

DBGET integrated database retrieval system