KEGG   Oryzias latipes (Japanese medaka): 101166940Help
Entry
101166940         CDS       T02443                                 

Definition
NAD(P)(+)--arginine ADP-ribosyltransferase 2-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101166940
Cellular antigens [BR:ola04090]
 Proteins
  101166940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 314 aa AA seqDB search
MTRFVFLLLCFSADMRLLTAKTKTEGNIFSKASYGPQINPGKSSSQETVKSVFAAPEEPH
GAENVSSQSVQQKATDASWKFSPHRWPLPLSLFPNSVDDMYYGCSNKMLIKVKRDYLPKS
TREGFQSTRTKLCASAAMQSRDPYDPLSWDHFRALCAYTAGAYDSLNRAVREGKASYNSS
FQFHALHFFLSDAIRLLKLNQRTCYTAVRRSRRLFVGEPGQTIRFGSFASSSLNKKLFNF
GRTTCFEIRTCFGAYLKSYSDFGADEDEVLIPPYEMFRITSVDESGRNPLECEVLYTLET
AGIYSTLNCQAVDL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgactcggttcgtctttctcctcctctgtttctctgctgacatgaggcttctgacggca
aaaacaaaaactgaaggaaacatcttctccaaagcttcttatggcccacaaatcaaccct
ggaaagtcttcttcacaggaaacagtcaagtctgtctttgccgctccagaagaaccccat
ggggcggaaaacgtctcctcccagtcggtccaacagaaagccacagatgcttcctggaag
ttttctcctcatcggtggcccctccctctgagcttgttccctaactccgtggatgacatg
tactacggctgctccaacaagatgctcatcaaagtcaaacgagactacctccccaaaagc
accagggaaggtttccagagcacgcgaaccaagctgtgtgcttctgcagccatgcagagc
cgggacccgtatgatccgctgtcctgggatcatttcagggctctgtgcgcctacacggcg
ggcgcctacgacagcctgaaccgcgccgtccgtgagggaaaggcttcctacaacagctcc
tttcaattccacgccctccacttctttctgtccgacgccatccggctgctgaaactgaac
cagaggacgtgttacaccgcggtcagaaggagcaggaggctcttcgtcggggaaccggga
caaaccatccgctttggctcctttgcttccagctcactcaacaaaaagttgttcaatttt
ggacggacaacctgctttgagatccgcacctgctttggtgcttacctgaagtcctactcg
gactttggcgcagacgaggacgaagtgctgattcccccgtatgagatgttccggataacc
tcggtggacgagtcggggagaaatcctttagagtgtgaggttctctacacgcttgagact
gctgggatctacagcaccctcaactgtcaggctgtggacctctga

DBGET integrated database retrieval system